PDB entry 5bkc

View 5bkc on RCSB PDB site
Description: Crystal structure of AAD-1 in complex with (R)-diclofop, Mn(II), and 2-oxoglutarate
Class: oxidoreductase
Keywords: dioxygenase, herbicide degradation, OXIDOREDUCTASE
Deposited on 2019-06-02, released 2019-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (R)-phenoxypropionate/alpha-ketoglutarate-dioxygenase
    Species: Delftia acidovorans [TaxId:80866]
    Gene: rdpA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5bkca_
  • Chain 'B':
    Compound: (R)-phenoxypropionate/alpha-ketoglutarate-dioxygenase
    Species: Delftia acidovorans [TaxId:80866]
    Gene: rdpA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5bkcb_
  • Heterogens: O0D, MN, AKG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bkcA (A:)
    mhaalsplsqrferiavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgq
    aitneqhiafsrrfgpvdpvpllksiegypevqmirreanesgrvigddwhtdstfldap
    paavvmraidvpehggdtgflsmytawetlsptmqatieglnvvhsatrvfgslyqaqnr
    rfsntsvkvmdvdagdretvhplvvthpgsgrkglyvnqvycqriegmtdaeskpllqfl
    yehatrfdftcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttvggvrpar
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bkcA (A:)
    plsqrferiavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneq
    hiafsrrfgpvdpvpllksiegypevqmirreanesgrvigddwhtdstfldappaavvm
    raidvpehggdtgflsmytawetlsptmqatieglnvvhsatrvfgslyqaqnrrfsnts
    vkvmdvdagdretvhplvvthpgsgrkglyvnqvycqriegmtdaeskpllqflyehatr
    fdftcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttvggvrpar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bkcB (B:)
    mhaalsplsqrferiavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgq
    aitneqhiafsrrfgpvdpvpllksiegypevqmirreanesgrvigddwhtdstfldap
    paavvmraidvpehggdtgflsmytawetlsptmqatieglnvvhsatrvfgslyqaqnr
    rfsntsvkvmdvdagdretvhplvvthpgsgrkglyvnqvycqriegmtdaeskpllqfl
    yehatrfdftcrvrwkkdqvlvwdnlctmhravpdyagkfryltrttvggvrpar
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bkcB (B:)
    feriavqpltgvlgaeitgvdlreplddstwneildafhtyqviyfpgqaitneqhiafs
    rrfgpvdpvpllksiegypevqmirreanesgrvigddwhtdstfldappaavvmraidv
    pehggdtgflsmytawetlsptmqatieglnvvhsatrvfgdagdretvhplvvthpgsg
    rkglyvnqvycqriegmtdaeskpllqflyehatrfdftcrvrwkkdqvlvwdnlctmhr
    avpdyagkfryltrttvggvrpar