PDB entry 5bj4

View 5bj4 on RCSB PDB site
Description: thermus thermophilus aspartate aminotransferase tetra mutant 2
Class: transferase
Keywords: aminotransferase, pyridoxal enzyme, transferase
Deposited on 1999-01-11, released 2003-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.185
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (aspartate aminotransferase)
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56232 (0-End)
      • engineered (100)
      • engineered (260)
    Domains in SCOPe 2.08: d5bj4a_
  • Chain 'B':
    Compound: protein (aspartate aminotransferase)
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56232 (0-End)
      • engineered (100)
      • engineered (260)
    Domains in SCOPe 2.08: d5bj4b_
  • Heterogens: PO4, PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bj4A (A:)
    mrglsrrvqamkpdavvavnakalelrrqgvdlvaltagepdfdtpehvkeaarralaqg
    ktkyappagipelrealaekfrrenglsvtpeetivtvggsqalfnlfqaildpgdeviv
    lspywvsypemvrfaggvvvevetlpeegfvpdpervrraitprtkalvvnspnnptgav
    ypkevlealarlavehdfylvsdeiyehllyegehfspgrvapehtltvngaakafamtg
    wrigyacgpkevikamasvsrqsttspdtiaqwatlealtnqeasrafvemareayrrrr
    dlllegltalglkavrpsgafyvlmdtspiapdevraaerlleagvavvpgtdfaafghv
    rlsyatseenlrkalerfarvlgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bj4A (A:)
    mrglsrrvqamkpgvdlvaltagepdfdtpehvkeaarralaqgktkyappagipelrea
    laekfrrenglsvtpeetivtvggsqalfnlfqaildpgdevivlspywvsypemvrfag
    gvvvevetlpeegfvpdpervrraitprtkalvvnspnnptgavypkevlealarlaveh
    dfylvsdeiyehllyegehfspgrvapehtltvngaakafamtgwrigyacgpkevikam
    asvsrqsttspdtiaqwatlealtnqeasrafvemareayrrrrdlllegltalglkavr
    psgafyvlmdtspiapdevraaerlleagvavvpgtdfaafghvrlsyatseenlrkale
    rfarvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bj4B (B:)
    mrglsrrvqamkpdavvavnakalelrrqgvdlvaltagepdfdtpehvkeaarralaqg
    ktkyappagipelrealaekfrrenglsvtpeetivtvggsqalfnlfqaildpgdeviv
    lspywvsypemvrfaggvvvevetlpeegfvpdpervrraitprtkalvvnspnnptgav
    ypkevlealarlavehdfylvsdeiyehllyegehfspgrvapehtltvngaakafamtg
    wrigyacgpkevikamasvsrqsttspdtiaqwatlealtnqeasrafvemareayrrrr
    dlllegltalglkavrpsgafyvlmdtspiapdevraaerlleagvavvpgtdfaafghv
    rlsyatseenlrkalerfarvlgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bj4B (B:)
    mrglsrrvqamkpgvdlvaltagepdfdtpehvkeaarralaqgktkyappagipelrea
    laekfrrenglsvtpeetivtvggsqalfnlfqaildpgdevivlspywvsypemvrfag
    gvvvevetlpeegfvpdpervrraitprtkalvvnspnnptgavypkevlealarlaveh
    dfylvsdeiyehllyegehfspgrvapehtltvngaakafamtgwrigyacgpkevikam
    asvsrqsttspdtiaqwatlealtnqeasrafvemareayrrrrdlllegltalglkavr
    psgafyvlmdtspiapdevraaerlleagvavvpgtdfaafghvrlsyatseenlrkale
    rfarvl