PDB entry 5bj3

View 5bj3 on RCSB PDB site
Description: thermus thermophilus aspartate aminotransferase tetra mutant 1
Class: transferase
Keywords: aminotransferase, pyridoxal enzyme, transferase
Deposited on 1999-01-11, released 2003-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.215
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (aspartate aminotransferase)
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56232 (0-End)
      • engineered (100)
      • engineered (260)
    Domains in SCOPe 2.07: d5bj3a_
  • Chain 'B':
    Compound: protein (aspartate aminotransferase)
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56232 (0-End)
      • engineered (100)
      • engineered (260)
    Domains in SCOPe 2.07: d5bj3b_
  • Chain 'C':
    Compound: protein (aspartate aminotransferase)
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56232 (0-End)
      • engineered (100)
      • engineered (260)
    Domains in SCOPe 2.07: d5bj3c_
  • Chain 'D':
    Compound: protein (aspartate aminotransferase)
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56232 (0-End)
      • engineered (100)
      • engineered (260)
    Domains in SCOPe 2.07: d5bj3d_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5bj3A (A:)
    mrglsrrvqamkpdapvavnakalelrrqgvdlvaltagepdfdtpehvkeaarralaqg
    ktkyappagipelrealaekfrrenglsvtpeetivtvggsqalfnlfqaildpgdeviv
    lspywvsypemvrfaggvvvevetlpeegfvpdpervrraitprtkalvvnspnnptgav
    ypkevlealarlavehdfylvsdeiyehllyegehfspgrvapehtltvngaakafamtg
    wrigyacgpkevikamasvsrqsttspdtiaqwatlealtnqeasrafvemareayrrrr
    dlllegltalglkavrpsgafyvlmdtspiapdevraaerlleagvavvpgtdfaafghv
    rlsyatseenlrkalerfarvlgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bj3A (A:)
    mrglsrrvqamkplvaltagepdfdtpehvkeaarralaqgktkyappagipelrealae
    kfrrenglsvtpeetivtvggsqalfnlfqaildpgdevivlspywvsypemvrfaggvv
    vevetlpeegfvpdpervrraitprtkalvvnspnnptgavypkevlealarlavehdfy
    lvsdeiyehllyegehfspgrvapehtltvngaakafamtgwrigyacgpkevikamasv
    srqsttspdtiaqwatlealtnqeasrafvemareayrrrrdlllegltalglkavrpsg
    afyvlmdtspiapdevraaerlleagvavvpgtdfaafghvrlsyatseenlrkalerfa
    rvl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5bj3B (B:)
    mrglsrrvqamkpdapvavnakalelrrqgvdlvaltagepdfdtpehvkeaarralaqg
    ktkyappagipelrealaekfrrenglsvtpeetivtvggsqalfnlfqaildpgdeviv
    lspywvsypemvrfaggvvvevetlpeegfvpdpervrraitprtkalvvnspnnptgav
    ypkevlealarlavehdfylvsdeiyehllyegehfspgrvapehtltvngaakafamtg
    wrigyacgpkevikamasvsrqsttspdtiaqwatlealtnqeasrafvemareayrrrr
    dlllegltalglkavrpsgafyvlmdtspiapdevraaerlleagvavvpgtdfaafghv
    rlsyatseenlrkalerfarvlgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bj3B (B:)
    mrglsrrvqamkplvaltagepdfdtpehvkeaarralaqgktkyappagipelrealae
    kfrrenglsvtpeetivtvggsqalfnlfqaildpgdevivlspywvsypemvrfaggvv
    vevetlpeegfvpdpervrraitprtkalvvnspnnptgavypkevlealarlavehdfy
    lvsdeiyehllyegehfspgrvapehtltvngaakafamtgwrigyacgpkevikamasv
    srqsttspdtiaqwatlealtnqeasrafvemareayrrrrdlllegltalglkavrpsg
    afyvlmdtspiapdevraaerlleagvavvpgtdfaafghvrlsyatseenlrkalerfa
    rvl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5bj3C (C:)
    mrglsrrvqamkpdapvavnakalelrrqgvdlvaltagepdfdtpehvkeaarralaqg
    ktkyappagipelrealaekfrrenglsvtpeetivtvggsqalfnlfqaildpgdeviv
    lspywvsypemvrfaggvvvevetlpeegfvpdpervrraitprtkalvvnspnnptgav
    ypkevlealarlavehdfylvsdeiyehllyegehfspgrvapehtltvngaakafamtg
    wrigyacgpkevikamasvsrqsttspdtiaqwatlealtnqeasrafvemareayrrrr
    dlllegltalglkavrpsgafyvlmdtspiapdevraaerlleagvavvpgtdfaafghv
    rlsyatseenlrkalerfarvlgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bj3C (C:)
    mrglsrrvqamkplvaltagepdfdtpehvkeaarralaqgktkyappagipelrealae
    kfrrenglsvtpeetivtvggsqalfnlfqaildpgdevivlspywvsypemvrfaggvv
    vevetlpeegfvpdpervrraitprtkalvvnspnnptgavypkevlealarlavehdfy
    lvsdeiyehllyegehfspgrvapehtltvngaakafamtgwrigyacgpkevikamasv
    srqsttspdtiaqwatlealtnqeasrafvemareayrrrrdlllegltalglkavrpsg
    afyvlmdtspiapdevraaerlleagvavvpgtdfaafghvrlsyatseenlrkalerfa
    rvl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5bj3D (D:)
    mrglsrrvqamkpdapvavnakalelrrqgvdlvaltagepdfdtpehvkeaarralaqg
    ktkyappagipelrealaekfrrenglsvtpeetivtvggsqalfnlfqaildpgdeviv
    lspywvsypemvrfaggvvvevetlpeegfvpdpervrraitprtkalvvnspnnptgav
    ypkevlealarlavehdfylvsdeiyehllyegehfspgrvapehtltvngaakafamtg
    wrigyacgpkevikamasvsrqsttspdtiaqwatlealtnqeasrafvemareayrrrr
    dlllegltalglkavrpsgafyvlmdtspiapdevraaerlleagvavvpgtdfaafghv
    rlsyatseenlrkalerfarvlgra
    

    Sequence, based on observed residues (ATOM records): (download)
    >5bj3D (D:)
    mrglsrrvqamkplvaltagepdfdtpehvkeaarralaqgktkyappagipelrealae
    kfrrenglsvtpeetivtvggsqalfnlfqaildpgdevivlspywvsypemvrfaggvv
    vevetlpeegfvpdpervrraitprtkalvvnspnnptgavypkevlealarlavehdfy
    lvsdeiyehllyegehfspgrvapehtltvngaakafamtgwrigyacgpkevikamasv
    srqsttspdtiaqwatlealtnqeasrafvemareayrrrrdlllegltalglkavrpsg
    afyvlmdtspiapdevraaerlleagvavvpgtdfaafghvrlsyatseenlrkalerfa
    rvl