PDB entry 5b8i

View 5b8i on RCSB PDB site
Description: Crystal structure of Calcineurin A and Calcineurin B in complex with FKBP12 and FK506 from Coccidioides immitis RS
Class: hydrolase
Keywords: SSGCID, NIH, NIAID, SBRI, UW, BERYLLIUM, PHOSPHATASE, CALCINEURIN, FKBP12, FK506, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, HYDROLASE
Deposited on 2015-05-03, released 2015-05-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein phosphatase
    Species: Coccidioides immitis (strain RS) [TaxId:246410]
    Gene: CIMG_06667
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b8ia_
  • Chain 'B':
    Compound: Calcineurin subunit B, variant
    Species: Coccidioides immitis (strain RS) [TaxId:246410]
    Gene: CIMG_02704
    Database cross-references and differences (RAF-indexed):
    • Uniprot I9NKL8 (1-170)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5b8ib_
  • Chain 'C':
    Compound: peptidyl-prolyl cis-trans isomerase
    Species: Coccidioides immitis (strain RS) [TaxId:246410]
    Gene: CIMG_08666
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b8ic_
  • Heterogens: ZN, FE, MES, EDO, CA, FK5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5b8iA (A:)
    mgsshhhhhhssgenlyfqgsedgtqvstlervckevqapafhtptneqfwspvdpskpn
    laflkqhfyregrltedqalwiiqagtellraepnllemdapitvcgdvhgqyydlmklf
    evggdpaetrylflgdyvdrgyfsiecvlylwalkiwypntlwllrgnhecrhltdyftf
    kleckhkysekvydacmesfcalplaaimnkqflcihgglspelhtlediksidrfrepp
    thglmcdilwadpledfgtektgeyfvhnnvrgcsfffsypaacafleknnllsiirahe
    aqdagyrmyqktrttgfpsvmtifsapnyldvynnkaavlkyennvmnirqfnctphpyw
    lpnfmdvftwslpfvgekitdmliailntc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b8iA (A:)
    lervckevqapafhtptneqfwspvdpskpnlaflkqhfyregrltedqalwiiqagtel
    lraepnllemdapitvcgdvhgqyydlmklfevggdpaetrylflgdyvdrgyfsiecvl
    ylwalkiwypntlwllrgnhecrhltdyftfkleckhkysekvydacmesfcalplaaim
    nkqflcihgglspelhtlediksidrfreppthglmcdilwadpledfgtektgeyfvhn
    nvrgcsfffsypaacafleknnllsiiraheaqdagyrmyqktrttgfpsvmtifsapny
    ldvynnkaavlkyennvmnirqfnctphpywlpnfmdvftwslpfvgekitdmliailn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5b8iB (B:)
    mssqvlndivsgsnfdheevdrlwkrfmkldrdksgtierdeflslpqvssnplstrmia
    ifdedgggdvdfqefvsglsafsskgnkeeklrfafkvydidrdgfisngelfivlkmmv
    gsnlkdmqlqqivdktimeadldgdgrisfeeftrmventdvsmsmtldqf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5b8iC (C:)
    mwshpqfekgsgvtkkilkegngvdkpvkgddivmnyrgclydsskpsehfmgrkfdste
    ergefktkigigvvirgwdeavlqmslgeksiltitddyaygargfpglipphatlvfev
    elkginskra
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b8iC (C:)
    gvtkkilkegngvdkpvkgddivmnyrgclydsskpsehfmgrkfdsteergefktkigi
    gvvirgwdeavlqmslgeksiltitddyaygargfpglipphatlvfevelkginskra