PDB entry 5b84

View 5b84 on RCSB PDB site
Description: X-ray crystal structure of met I107Y sperm whale myoglobin
Class: oxygen storage
Keywords: oxygen storage
Deposited on 2016-06-12, released 2016-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-152)
      • engineered mutation (106)
    Domains in SCOPe 2.07: d5b84a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5b84A (A:)
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefyseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg