PDB entry 5b84

View 5b84 on RCSB PDB site
Description: X-ray crystal struture of met I107Y sperm whale myoglobin
Class: oxygen storage
Keywords: oxygen storage
Deposited on 2016-06-12, released 2016-08-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-08-24, with a file datestamp of 2016-08-18.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-152)
      • engineered mutation (106)
    Domains in SCOPe 2.06: d5b84a_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5b84A (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefyseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg