PDB entry 5b7s

View 5b7s on RCSB PDB site
Description: Apo structure of Cysteine Desulfurase from Thermococcus onnurineus NA1
Class: transferase
Keywords: Cysteine desulfurase, L-cysteine, Metabolic pathways, TRANSFERASE
Deposited on 2016-06-08, released 2017-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cysteine desulfurase
    Species: Thermococcus onnurineus (strain NA1) [TaxId:523850]
    Gene: TON_0289
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6YT87 (20-End)
      • expression tag (18-19)
    Domains in SCOPe 2.07: d5b7sa1, d5b7sa2
  • Chain 'B':
    Compound: Cysteine desulfurase
    Species: Thermococcus onnurineus (strain NA1) [TaxId:523850]
    Gene: TON_0289
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6YT87 (20-End)
      • expression tag (17-19)
    Domains in SCOPe 2.07: d5b7sb1, d5b7sb2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5b7sA (A:)
    mhhhhhhssenlyfqghmasmripedvrkdipltneviyfdntatsltpkpvveamdeyy
    lkyranvhrgvhrlsqmathkyeesrkivadfigakfeeivftkntseslnlvalglghi
    fkrgdkivttpyehhsdllpwqrlatklglklefiegddegnldlsdaekkikgaklvav
    qhvsnalgviheveelgkiakdegaifvvdaaqsaghmevnvkklhadflafsghkgpmg
    ptgigvlyireeffdtfeppligggtiedvsldgykltepperfeagtpniggaiglaag
    iryieriglgrierqehklvkrttegldelevpwygprnlkkhagvvsfnvpglhphdva
    ailddhsimvrsghhcalpvmkklgingtvrasfhvynsleevetflgvmeelvkglkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b7sA (A:)
    asmripedvrkdipltneviyfdntatsltpkpvveamdeyylkyranvhrgvhrlsqma
    thkyeesrkivadfigakfeeivftkntseslnlvalglghifkrgdkivttpyehhsdl
    lpwqrlatklglklefiegddegnldlsdaekkikgaklvavqhvsnalgviheveelgk
    iakdegaifvvdaaqsaghmevnvkklhadflafsghkgpmgptgigvlyireeffdtfe
    ppligggtiedvsldgykltepperfeagtpniggaiglaagiryieriglgrierqehk
    lvkrttegldelevpwygprnlkkhagvvsfnvpglhphdvaailddhsimvrsghhcal
    pvmkklgingtvrasfhvynsleevetflgvmeelvk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5b7sB (B:)
    mhhhhhhssenlyfqghmasmripedvrkdipltneviyfdntatsltpkpvveamdeyy
    lkyranvhrgvhrlsqmathkyeesrkivadfigakfeeivftkntseslnlvalglghi
    fkrgdkivttpyehhsdllpwqrlatklglklefiegddegnldlsdaekkikgaklvav
    qhvsnalgviheveelgkiakdegaifvvdaaqsaghmevnvkklhadflafsghkgpmg
    ptgigvlyireeffdtfeppligggtiedvsldgykltepperfeagtpniggaiglaag
    iryieriglgrierqehklvkrttegldelevpwygprnlkkhagvvsfnvpglhphdva
    ailddhsimvrsghhcalpvmkklgingtvrasfhvynsleevetflgvmeelvkglkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b7sB (B:)
    masmripedvrkdipltneviyfdntatsltpkpvveamdeyylkyranvhrgvhrlsqm
    athkyeesrkivadfigakfeeivftkntseslnlvalglghifkrgdkivttpyehhsd
    llpwqrlatklglklefiegddegnldlsdaekkikgaklvavqhvsnalgviheveelg
    kiakdegaifvvdaaqsaghmevnvkklhadflafsghkgpmgptgigvlyireeffdtf
    eppligggtiedvsldgykltepperfeagtpniggaiglaagiryieriglgrierqeh
    klvkrttegldelevpwygprnlkkhagvvsfnvpglhphdvaailddhsimvrsghhca
    lpvmkklgingtvrasfhvynsleevetflgvmeelvkgl