PDB entry 5b6p

View 5b6p on RCSB PDB site
Description: Structure of the dodecameric type-II dehydrogenate dehydratase from Acinetobacter baumannii at 2.00 A resolution
Class: lyase
Keywords: lyase
Deposited on 2016-05-31, released 2016-09-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-07, with a file datestamp of 2016-09-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b6pa_
  • Chain 'B':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b6pb_
  • Chain 'C':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b6pc_
  • Chain 'D':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b6pd_
  • Chain 'E':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b6pe_
  • Chain 'F':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b6pf_
  • Chain 'G':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b6pg_
  • Chain 'H':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b6ph_
  • Chain 'I':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b6pi_
  • Chain 'J':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b6pj_
  • Chain 'K':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b6pk_
  • Chain 'L':
    Compound: 3-dehydroquinate dehydratase
    Species: Acinetobacter baumannii [TaxId:400667]
    Gene: aroQ, A1S_2009
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b6pl_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5b6pA (A:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b6pA (A:)
    stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
    hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
    igvicglgakgysfaldyaiekiqp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5b6pB (B:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b6pB (B:)
    stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
    hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
    igvicglgakgysfaldyaiekiqp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5b6pC (C:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b6pC (C:)
    stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
    hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
    igvicglgakgysfaldyaiekiqp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5b6pD (D:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b6pD (D:)
    stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
    hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
    igvicglgakgysfaldyaiekiqp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5b6pE (E:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b6pE (E:)
    stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
    hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
    igvicglgakgysfaldyaiekiqp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5b6pF (F:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b6pF (F:)
    stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
    hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
    igvicglgakgysfaldyaiekiqp
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5b6pG (G:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b6pG (G:)
    stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
    hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
    igvicglgakgysfaldyaiekiqp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5b6pH (H:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b6pH (H:)
    stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
    hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
    igvicglgakgysfaldyaiekiqp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5b6pI (I:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b6pI (I:)
    stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
    hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
    igvicglgakgysfaldyaiekiqp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5b6pJ (J:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b6pJ (J:)
    stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
    hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
    igvicglgakgysfaldyaiekiqp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5b6pK (K:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b6pK (K:)
    stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
    hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
    igvicglgakgysfaldyaiekiqp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5b6pL (L:)
    msstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivd
    rihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsd
    kaigvicglgakgysfaldyaiekiqpsnpn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b6pL (L:)
    stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
    hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
    igvicglgakgysfaldyaiekiqp