PDB entry 5b6i

View 5b6i on RCSB PDB site
Description: Structure of fluorinase from Streptomyces sp. MA37
Class: transferase
Keywords: transferase
Deposited on 2016-05-29, released 2016-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-16, with a file datestamp of 2016-11-11.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fluorinase
    Species: Streptomyces sp. MA37 [TaxId:1400207]
    Gene: flA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b6ia1, d5b6ia2
  • Chain 'B':
    Compound: Fluorinase
    Species: Streptomyces sp. MA37 [TaxId:1400207]
    Gene: flA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b6ib1, d5b6ib2
  • Heterogens: MET, ADN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5b6iA (A:)
    mgsshhhhhhssglvprgshmaangsqrpiiafmsdlgttddsvaqckglmhsicpgvtv
    vdvchsmtpwdveegaryivdlprffpegtvfatttypatgtttrsvavrirqaakggar
    gqwagsgdgferadgsyiyiapnngllttvleehgyieayevtstkvipanpeptfysre
    mvaipsahlaagfplaevgrrlddseivrfhrpaveisgealsgvvtaidhpfgniwtni
    hrtdlekagigqgkhlkiilddvlpfeapltptfadagaigniafylnsrgylslarnaa
    slaypynlkaglkvrvear
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b6iA (A:)
    rpiiafmsdlgttddsvaqckglmhsicpgvtvvdvchsmtpwdveegaryivdlprffp
    egtvfatttypatgtttrsvavrirqaakggargqwagsgdgferadgsyiyiapnngll
    ttvleehgyieayevtstkvipanpeptfysremvaipsahlaagfplaevgrrlddsei
    vrfhrpaveisgealsgvvtaidhpfgniwtnihrtdlekagigqgkhlkiilddvlpfe
    apltptfadagaigniafylnsrgylslarnaaslaypynlkaglkvrvear
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5b6iB (B:)
    mgsshhhhhhssglvprgshmaangsqrpiiafmsdlgttddsvaqckglmhsicpgvtv
    vdvchsmtpwdveegaryivdlprffpegtvfatttypatgtttrsvavrirqaakggar
    gqwagsgdgferadgsyiyiapnngllttvleehgyieayevtstkvipanpeptfysre
    mvaipsahlaagfplaevgrrlddseivrfhrpaveisgealsgvvtaidhpfgniwtni
    hrtdlekagigqgkhlkiilddvlpfeapltptfadagaigniafylnsrgylslarnaa
    slaypynlkaglkvrvear
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b6iB (B:)
    rpiiafmsdlgttddsvaqckglmhsicpgvtvvdvchsmtpwdveegaryivdlprffp
    egtvfatttypatgtttrsvavrirqaawagsgdgferadgsyiyiapnngllttvleeh
    gyieayevtstkvipanpeptfysremvaipsahlaagfplaevgrrlddseivrfhrpa
    veisgealsgvvtaidhpfgniwtnihrtdlekagigqgkhlkiilddvlpfeapltptf
    adagaigniafylnsrgylslarnaaslaypynlkaglkvrvear