PDB entry 5b5w

View 5b5w on RCSB PDB site
Description: Crystal structure of MOB1-LATS1 NTR domain complex
Class: metal binding protein/apotosis
Keywords: MOB1 LATS1 Hippo pathway, METAL BINDING PROTEIN-APOTOSIS complex
Deposited on 2016-05-24, released 2016-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-06, with a file datestamp of 2016-07-01.
Experiment type: XRAY
Resolution: 2.96 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MOB kinase activator 1B
    Species: Mus musculus [TaxId:10090]
    Gene: Mob1b, Mobkl1a
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b5wa_
  • Chain 'U':
    Compound: Serine/threonine-protein kinase LATS1
    Species: Homo sapiens [TaxId:9606]
    Gene: LATS1, WARTS
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5b5wA (A:)
    gpeatlgsgnlrmavmlpegedlnewvavntvdffnqinmlygtitdfcteescpvmsag
    pkyeyhwadgtnikkpikcsapkyidylmtwvqdqlddetlfpskigvpfpknfmsvakt
    ilkrlfrvyahiyhqhfdpviqlqeeahlntsfkhfiffvqefnlidrrelaplqeliek
    ltskdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b5wA (A:)
    gnlrmavmlpegedlnewvavntvdffnqinmlygtitdfcteescpvmsagpkyeyhwa
    dgkkpikcsapkyidylmtwvqdqlddetlfpskigvpfpknfmsvaktilkrlfrvyah
    iyhqhfdpviqlqeeahlntsfkhfiffvqefnlidrrelaplqelieklts
    

  • Chain 'U':
    No sequence available.