PDB entry 5b5g

View 5b5g on RCSB PDB site
Description: Crystal structure of ALiS4-Streptavidin complex
Class: biotin-binding protein
Keywords: BIOTIN-BINDING PROTEIN, high-strength agarose hydrogel
Deposited on 2016-05-04, released 2017-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-01, with a file datestamp of 2017-02-24.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b5ga_
  • Chain 'B':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b5gb_
  • Chain 'C':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b5gc_
  • Chain 'D':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b5gd_
  • Heterogens: SO3, 6FX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5b5gA (A:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5b5gB (B:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5b5gC (C:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5b5gD (D:)
    gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
    tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvkp