PDB entry 5b4l

View 5b4l on RCSB PDB site
Description: Crystal structure of the catalytic domain of human PDE10A complexed with 1-(cyclopropylmethyl)-5-(2-(2,3-dihydro-1H-imidazo[1,2-a]benzimidazol-1-yl)ethoxy)-3-(1-phenyl-1H-pyrazol-5-yl)pyridazin-4(1H)-one
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2016-04-05, released 2016-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-03, with a file datestamp of 2016-07-29.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b4la_
  • Chain 'B':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b4lb_
  • Heterogens: MG, ZN, 6DW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5b4lA (A:)
    tseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrf
    imsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfs
    nsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaii
    atdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltand
    iyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepl
    lkacrdnlsqwekvirgeetatwisspsvaqkaaased
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b4lA (A:)
    ewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfims
    vkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsy
    lqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatd
    lalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiya
    efwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllka
    crdnlsqwekvirge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5b4lB (B:)
    tseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrf
    imsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfs
    nsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaii
    atdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltand
    iyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepl
    lkacrdnlsqwekvirgeetatwisspsvaqkaaased
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b4lB (B:)
    ewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfims
    vkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsy
    lqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatd
    lalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiya
    efwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllka
    crdnlsqwekvirgee