PDB entry 5b25

View 5b25 on RCSB PDB site
Description: Crystal structure of human PDE1B with inhibitor 3
Class: hydrolase/hydrolase inhibitor
Keywords: Hydrolase, Inhibitor, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2016-01-07, released 2016-02-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-24, with a file datestamp of 2016-02-19.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE1B, PDE1B1, PDES1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b25a_
  • Chain 'B':
    Compound: Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE1B, PDE1B1, PDES1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b25b_
  • Chain 'C':
    Compound: Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE1B, PDE1B1, PDES1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b25c_
  • Chain 'D':
    Compound: Calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE1B, PDE1B1, PDES1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b25d_
  • Heterogens: ZN, MG, 4QJ, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5b25A (A:)
    vgptystavlnclknldlwcfdvfslnqaaddhalrtivfelltrhnlisrfkiptvflm
    sfldaletgygkyknpyhnqihaadvtqtvhcfllrtgmvhclseiellaiifaaaihdy
    ehtgttnsfhiqtksecaivyndrsvlenhhissvfrlmqddemnifinltkdefvelra
    lviemvlatdmschfqqvktmktalqqleridkpkalslllhaadishptkqwlvhsrwt
    kalmeeffrqgdkeaelglpfsplcdrtstlvaqsqigfidfiveptfsvltdvaeksvq
    plagdpnpdvvsfrstwvkriqenkqkwkeraasgitn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b25A (A:)
    tystavlnclknldlwcfdvfslnqaaddhalrtivfelltrhnlisrfkiptvflmsfl
    daletgygkyknpyhnqihaadvtqtvhcfllrtgmvhclseiellaiifaaaihdyeht
    gttnsfhiqtksecaivyndrsvlenhhissvfrlmqddemnifinltkdefvelralvi
    emvlatdmschfqqvktmktalqqleridkpkalslllhaadishptkqwlvhsrwtkal
    meeffrqgdkeaelglpfsplcdrtstlvaqsqigfidfiveptfsvltdvaeksvqpla
    gdpnpdvvsfrstwvkriqenkqkwkeraasgitn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5b25B (B:)
    vgptystavlnclknldlwcfdvfslnqaaddhalrtivfelltrhnlisrfkiptvflm
    sfldaletgygkyknpyhnqihaadvtqtvhcfllrtgmvhclseiellaiifaaaihdy
    ehtgttnsfhiqtksecaivyndrsvlenhhissvfrlmqddemnifinltkdefvelra
    lviemvlatdmschfqqvktmktalqqleridkpkalslllhaadishptkqwlvhsrwt
    kalmeeffrqgdkeaelglpfsplcdrtstlvaqsqigfidfiveptfsvltdvaeksvq
    plagdpnpdvvsfrstwvkriqenkqkwkeraasgitn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b25B (B:)
    tystavlnclknldlwcfdvfslnqaaddhalrtivfelltrhnlisrfkiptvflmsfl
    daletgygkyknpyhnqihaadvtqtvhcfllrtgmvhclseiellaiifaaaihdyeht
    gttnsfhiqtksecaivyndrsvlenhhissvfrlmqddemnifinltkdefvelralvi
    emvlatdmschfqqvktmktalqqleridkpkalslllhaadishptkqwlvhsrwtkal
    meeffrqgdkeaelglpfsplcdrtstlvaqsqigfidfiveptfsvltdvaeksvqpla
    gdpnpdvvsfrstwvkriqenkqkwkeraasg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5b25C (C:)
    vgptystavlnclknldlwcfdvfslnqaaddhalrtivfelltrhnlisrfkiptvflm
    sfldaletgygkyknpyhnqihaadvtqtvhcfllrtgmvhclseiellaiifaaaihdy
    ehtgttnsfhiqtksecaivyndrsvlenhhissvfrlmqddemnifinltkdefvelra
    lviemvlatdmschfqqvktmktalqqleridkpkalslllhaadishptkqwlvhsrwt
    kalmeeffrqgdkeaelglpfsplcdrtstlvaqsqigfidfiveptfsvltdvaeksvq
    plagdpnpdvvsfrstwvkriqenkqkwkeraasgitn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b25C (C:)
    tystavlnclknldlwcfdvfslnqaaddhalrtivfelltrhnlisrfkiptvflmsfl
    daletgygkyknpyhnqihaadvtqtvhcfllrtgmvhclseiellaiifaaaihdyeht
    gttnsfhiqtksecaivyndrsvlenhhissvfrlmqddemnifinltkdefvelralvi
    emvlatdmschfqqvktmktalqqleridkpkalslllhaadishptkqwlvhsrwtkal
    meeffrqgdkeaelglpfsplcdrtstlvaqsqigfidfiveptfsvltdvaeksvqpla
    gdpnpdvvsfrstwvkriqenkqkwkeraasg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5b25D (D:)
    vgptystavlnclknldlwcfdvfslnqaaddhalrtivfelltrhnlisrfkiptvflm
    sfldaletgygkyknpyhnqihaadvtqtvhcfllrtgmvhclseiellaiifaaaihdy
    ehtgttnsfhiqtksecaivyndrsvlenhhissvfrlmqddemnifinltkdefvelra
    lviemvlatdmschfqqvktmktalqqleridkpkalslllhaadishptkqwlvhsrwt
    kalmeeffrqgdkeaelglpfsplcdrtstlvaqsqigfidfiveptfsvltdvaeksvq
    plagdpnpdvvsfrstwvkriqenkqkwkeraasgitn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b25D (D:)
    tystavlnclknldlwcfdvfslnqaaddhalrtivfelltrhnlisrfkiptvflmsfl
    daletgygkyknpyhnqihaadvtqtvhcfllrtgmvhclseiellaiifaaaihdyeht
    gttnsfhiqtksecaivyndrsvlenhhissvfrlmqddemnifinltkdefvelralvi
    emvlatdmschfqqvktmktalqqleridkpkalslllhaadishptkqwlvhsrwtkal
    meeffrqgdkeaelglpfsplcdrtstlvaqsqigfidfiveptfsvltdvaeksvqpla
    gdpnpdvvsfrstwvkriqenkqkwkeraasg