PDB entry 5b1u

View 5b1u on RCSB PDB site
Description: Crystal Structure of Metallo-beta-Lactamase SMB-1 Bound to Hydrolyzed Imipenem
Class: hydrolase/antibiotic
Keywords: HYDROLASE, HYDROLASE-ANTIBIOTIC complex
Deposited on 2015-12-20, released 2016-05-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: XRAY
Resolution: 1.57 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metallo-beta-lactamase
    Species: Serratia marcescens [TaxId:615]
    Gene: SMB-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5b1ua_
  • Heterogens: ZN, NA, SO4, HIW, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5b1uA (A:)
    qdrdwsspqqpftiygnthyvgtggisavllsspqghilvdgttekgaqvvaaniramgf
    klsdvkyilsthshedhaggisamqkltgatvlagaanvdtlrtgvspksdpqfgslsnf
    pgsakvravadgelvklgplavkahatpghteggitwtwqsceqgkckdvvfadsltavs
    adsyrfsdhpevvaslrgsfeaveklscdiaiaahpevndmwtrqqraakegnsayvdng
    acraiaaagrkrletrlasekr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b1uA (A:)
    rdwsspqqpftiygnthyvgtggisavllsspqghilvdgttekgaqvvaaniramgfkl
    sdvkyilsthshedhaggisamqkltgatvlagaanvdtlrtgvspksdpqfgslsnfpg
    sakvravadgelvklgplavkahatpghteggitwtwqsceqgkckdvvfadsltavsad
    syrfsdhpevvaslrgsfeaveklscdiaiaahpevndmwtrqqraakegnsayvdngac
    raiaaagrkrletrlasek