PDB entry 5b1m

View 5b1m on RCSB PDB site
Description: The mouse nucleosome structure containing H3.1
Class: structural protein/DNA
Keywords: chromatin, DNA binding, histone-fold, STRUCTURAL PROTEIN-DNA complex
Deposited on 2015-12-08, released 2017-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-02-15, with a file datestamp of 2017-02-10.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H3.1
    Species: Mus musculus [TaxId:10090]
    Gene: Hist1h3a, H3a, Hist1h3g, H3.1-221, H3g, Hist1h3h, H3.1-291, H3h, Hist1h3i, H3.1-I, H3i
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b1ma_
  • Chain 'B':
    Compound: histone h4
    Species: Mus musculus [TaxId:10090]
    Gene: Hist1h4a, Hist1h4b, H4-53, Hist1h4c, H4-12, Hist1h4d, Hist1h4f, Hist1h4h, Hist1h4i, Hist1h4j, Hist1h4k, Hist1h4m, Hist2h4a, Hist2h4, Hist4h4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b1mb_
  • Chain 'C':
    Compound: Histone H2A type 1
    Species: Mus musculus [TaxId:10090]
    Gene: Hist1h2ab, Hist1h2ac, Hist1h2ad, Hist1h2ae, Hist1h2ag, Hist1h2ai, Hist1h2an, Hist1h2ao
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b1mc_
  • Chain 'D':
    Compound: Histone H2B type 3-A
    Species: Mus musculus [TaxId:10090]
    Gene: Hist3h2ba
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b1md_
  • Chain 'E':
    Compound: Histone H3.1
    Species: Mus musculus [TaxId:10090]
    Gene: Hist1h3a, H3a, Hist1h3g, H3.1-221, H3g, Hist1h3h, H3.1-291, H3h, Hist1h3i, H3.1-I, H3i
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b1me_
  • Chain 'F':
    Compound: histone h4
    Species: Mus musculus [TaxId:10090]
    Gene: Hist1h4a, Hist1h4b, H4-53, Hist1h4c, H4-12, Hist1h4d, Hist1h4f, Hist1h4h, Hist1h4i, Hist1h4j, Hist1h4k, Hist1h4m, Hist2h4a, Hist2h4, Hist4h4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b1mf_
  • Chain 'G':
    Compound: Histone H2A type 1
    Species: Mus musculus [TaxId:10090]
    Gene: Hist1h2ab, Hist1h2ac, Hist1h2ad, Hist1h2ae, Hist1h2ag, Hist1h2ai, Hist1h2an, Hist1h2ao
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b1mg_
  • Chain 'H':
    Compound: Histone H2B type 3-A
    Species: Mus musculus [TaxId:10090]
    Gene: Hist3h2ba
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5b1mh_
  • Chain 'I':
    Compound: DNA (146-mer)
    Species: Homo sapiens [TaxId:9606]
  • Chain 'J':
    Compound: DNA (146-mer)
    Species: Homo sapiens [TaxId:9606]
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5b1mA (A:)
    gshmartkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqk
    stellirklpfqrlvreiaqdfktdlrfqssavmalqeaceaylvglfedtnlcaihakr
    vtimpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b1mA (A:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeace
    aylvglfedtnlcaihakrvtimpkdiqlarrirger
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5b1mB (B:)
    gshmsgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrg
    vlkvflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b1mB (B:)
    niqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvtam
    dvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5b1mC (C:)
    gshmsgrgkqggkarakaktrssraglqfpvgrvhrllrkgnyservgagapvylaavle
    yltaeilelagnaardnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavll
    pkkteshhkakgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b1mC (C:)
    rakaktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaa
    rdnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5b1mD (D:)
    gshmpepsrstpapkkgskkaitkaqkkdgkkrkrgrkesysiyvykvlkqvhpdtgiss
    kamgimnsfvndiferiaseasrlahynkrstitsrevqtavrlllpgelakhavsegtk
    avtkytssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b1mD (D:)
    rgrkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiaseasrlahynkrstit
    srevqtavrlllpgelakhavsegtkavtkytss
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5b1mE (E:)
    gshmartkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqk
    stellirklpfqrlvreiaqdfktdlrfqssavmalqeaceaylvglfedtnlcaihakr
    vtimpkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b1mE (E:)
    kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeac
    eaylvglfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5b1mF (F:)
    gshmsgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrg
    vlkvflenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b1mF (F:)
    rkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakr
    ktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5b1mG (G:)
    gshmsgrgkqggkarakaktrssraglqfpvgrvhrllrkgnyservgagapvylaavle
    yltaeilelagnaardnkktriiprhlqlairndeelnkllgrvtiaqggvlpniqavll
    pkkteshhkakgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b1mG (G:)
    ktrssraglqfpvgrvhrllrkgnyservgagapvylaavleyltaeilelagnaardnk
    ktriiprhlqlairndeelnkllgrvtiaqggvlpniqavllpk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5b1mH (H:)
    gshmpepsrstpapkkgskkaitkaqkkdgkkrkrgrkesysiyvykvlkqvhpdtgiss
    kamgimnsfvndiferiaseasrlahynkrstitsrevqtavrlllpgelakhavsegtk
    avtkytssk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5b1mH (H:)
    rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiaseasrlahynkrstitsr
    evqtavrlllpgelakhavsegtkavtkytss
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.