PDB entry 5azs

View 5azs on RCSB PDB site
Description: Crystal structure of a membrane protein from Pseudomonas aeruginosa
Class: membrane protein
Keywords: Alpha barrel, Beta barrel, Membrane protein
Deposited on 2015-10-21, released 2016-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer membrane protein OprJ
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: oprJ, PA4597
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5azsa_
  • Chain 'B':
    Compound: Outer membrane protein OprJ
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: oprJ, PA4597
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5azsb_
  • Chain 'C':
    Compound: Outer membrane protein OprJ
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: oprJ, PA4597
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5azsc_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5azsA (A:)
    csmaptyerpaapvadswsgaaaqrqgaaidtldwksfivdaelrrlvdmaldnnrslrq
    tlldieaaraqyriqradrvpglnaaatgnrqrqpadlsagnrsevassyqvglalpeye
    ldlfgrvksltdaalqqylaseeaaraarialvaevsqaylsydgalrrlaltrqtlvsr
    eysfalidqrraagaataldyqealglveqaraeqernlrqkqqafnalvlllgsddaaq
    aiprspgqrpkllqdiapgtpselierrpdilaaehrlrarnadigaaraaffprisltg
    sfgtssaemsglfdggsrswsflptltlpifdggrnranlslaearkdsavaayegtiqt
    afrevadalaasdtlrreekalralanssnealklakaryesgvdnhlryldaqrssfln
    eiafidgstqrqialvdlfralgggwdegrslvvhrggrsgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5azsA (A:)
    csmaptyerpaapvadswsldwksfivdaelrrlvdmaldnnrslrqtlldieaaraqyr
    iqradrvpglnaaatgnrqrqpadlsagnrsevassyqvglalpeyeldlfgrvksltda
    alqqylaseeaaraarialvaevsqaylsydgalrrlaltrqtlvsreysfalidqrraa
    gaataldyqealglveqaraeqernlrqkqqafnalvlllgsddaaqaiprspgqrpkll
    qdiapgtpselierrpdilaaehrlrarnadigaaraaffprisltgsfgtssaemsglf
    dggsrswsflptltlpifdggrnranlslaearkdsavaayegtiqtafrevadalaasd
    tlrreekalralanssnealklakaryesgvdnhlryldaqrssflneiafidgstqrqi
    alvdlfralg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5azsB (B:)
    csmaptyerpaapvadswsgaaaqrqgaaidtldwksfivdaelrrlvdmaldnnrslrq
    tlldieaaraqyriqradrvpglnaaatgnrqrqpadlsagnrsevassyqvglalpeye
    ldlfgrvksltdaalqqylaseeaaraarialvaevsqaylsydgalrrlaltrqtlvsr
    eysfalidqrraagaataldyqealglveqaraeqernlrqkqqafnalvlllgsddaaq
    aiprspgqrpkllqdiapgtpselierrpdilaaehrlrarnadigaaraaffprisltg
    sfgtssaemsglfdggsrswsflptltlpifdggrnranlslaearkdsavaayegtiqt
    afrevadalaasdtlrreekalralanssnealklakaryesgvdnhlryldaqrssfln
    eiafidgstqrqialvdlfralgggwdegrslvvhrggrsgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5azsB (B:)
    csmaptyerpaapvadswsgaidtldwksfivdaelrrlvdmaldnnrslrqtlldieaa
    raqyriqradrvpglnaaatgnrqrqpadlsagnrsevassyqvglalpeyeldlfgrvk
    sltdaalqqylaseeaaraarialvaevsqaylsydgalrrlaltrqtlvsreysfalid
    qrraagaataldyqealglveqaraeqernlrqkqqafnalvlllgsddaaqaiprspgq
    rpkllqdiapgtpselierrpdilaaehrlrarnadigaaraaffprisltgsfgtssae
    msglfdggsrswsflptltlpifdggrnranlslaearkdsavaayegtiqtafrevada
    laasdtlrreekalralanssnealklakaryesgvdnhlryldaqrssflneiafidgs
    tqrqialvdlfralg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5azsC (C:)
    csmaptyerpaapvadswsgaaaqrqgaaidtldwksfivdaelrrlvdmaldnnrslrq
    tlldieaaraqyriqradrvpglnaaatgnrqrqpadlsagnrsevassyqvglalpeye
    ldlfgrvksltdaalqqylaseeaaraarialvaevsqaylsydgalrrlaltrqtlvsr
    eysfalidqrraagaataldyqealglveqaraeqernlrqkqqafnalvlllgsddaaq
    aiprspgqrpkllqdiapgtpselierrpdilaaehrlrarnadigaaraaffprisltg
    sfgtssaemsglfdggsrswsflptltlpifdggrnranlslaearkdsavaayegtiqt
    afrevadalaasdtlrreekalralanssnealklakaryesgvdnhlryldaqrssfln
    eiafidgstqrqialvdlfralgggwdegrslvvhrggrsgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5azsC (C:)
    csmaptyerpaapvadswsgidtldwksfivdaelrrlvdmaldnnrslrqtlldieaar
    aqyriqradrvpglnaaatgnrqrqpadlsagnrsevassyqvglalpeyeldlfgrvks
    ltdaalqqylaseeaaraarialvaevsqaylsydgalrrlaltrqtlvsreysfalidq
    rraagaataldyqealglveqaraeqernlrqkqqafnalvlllgsddaaqaiprspgqr
    pkllqdiapgtpselierrpdilaaehrlrarnadigaaraaffprisltgsfgtssaem
    sglfdggsrswsflptltlpifdggrnranlslaearkdsavaayegtiqtafrevadal
    aasdtlrreekalralanssnealklakaryesgvdnhlryldaqrssflneiafidgst
    qrqialvdlfralgggwdegrslvvh