PDB entry 5azp

View 5azp on RCSB PDB site
Description: Crystal structure of a membrane protein from Pseudomonas aeruginosa
Class: membrane protein
Keywords: Alpha barrel, Beta barrel, Membrane protein
Deposited on 2015-10-21, released 2016-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-02.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Multidrug efflux outer membrane protein OprN
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: oprN, PA2495
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5azpa_
  • Chain 'B':
    Compound: Multidrug efflux outer membrane protein OprN
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: oprN, PA2495
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I0Y7 (0-446)
      • expression tag (447-449)
    Domains in SCOPe 2.08: d5azpb1, d5azpb2
  • Chain 'C':
    Compound: Multidrug efflux outer membrane protein OprN
    Species: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) [TaxId:208964]
    Gene: oprN, PA2495
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5azpc_
  • Heterogens: 3PK, OYA, BOG, GOL, FMT, NA, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5azpA (A:)
    ctvgpdyrtpdtaaakidataskpydrsrfeslwwkqfddptlnqlveqslsgnrdlrva
    farlraaralrddvandrfpvvtsrasadigkgqqpgvtedrvnserydlgldsaweldl
    fgrirrqlessdalseaaeadlqqlqvsliaelvdaygqlrgaqlrekialsnlenqkes
    rqlteqlrdagvgaeldvlradarlaataasvpqlqaeaerarhriatllgqrpeeltvd
    lsprdlpaitkalpigdpgellrrrpdiraaerrlaastadvgvatadlfprvslsgflg
    ftagrgsqigssaarawsvgpsiswaafdlgsvrarlrgakadadaalasyeqqvllale
    esanafsdygkrqerlvslvrqseasraaaqqaairyregttdflvlldaereqlsaeda
    qaqaevelyrgivaiyrslgggwqpsagshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5azpA (A:)
    ctvgpdyrtpdtaaakidataskpydrsrfeslwwkqfddptlnqlveqslsgnrdlrva
    farlraaralrddvandrfpvvtsrasadigkgqqpgvtedrvnserydlgldsaweldl
    fgrirrqlessdalseaaeadlqqlqvsliaelvdaygqlrgaqlrekialsnlenqkes
    rqlteqlrdagvgaeldvlradarlaataasvpqlqaeaerarhriatllgqrpeeltvd
    lsprdlpaitkalpigdpgellrrrpdiraaerrlaastadvgvatadlfprvslsgflg
    ftagrgsqigssaarawsvgpsiswaafdlgsvrarlrgakadadaalasyeqqvllale
    esanafsdygkrqerlvslvrqseasraaaqqaairyregttdflvlldaereqlsaeda
    qaqaevelyrgivaiyrslgggwqps
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5azpB (B:)
    ctvgpdyrtpdtaaakidataskpydrsrfeslwwkqfddptlnqlveqslsgnrdlrva
    farlraaralrddvandrfpvvtsrasadigkgqqpgvtedrvnserydlgldsaweldl
    fgrirrqlessdalseaaeadlqqlqvsliaelvdaygqlrgaqlrekialsnlenqkes
    rqlteqlrdagvgaeldvlradarlaataasvpqlqaeaerarhriatllgqrpeeltvd
    lsprdlpaitkalpigdpgellrrrpdiraaerrlaastadvgvatadlfprvslsgflg
    ftagrgsqigssaarawsvgpsiswaafdlgsvrarlrgakadadaalasyeqqvllale
    esanafsdygkrqerlvslvrqseasraaaqqaairyregttdflvlldaereqlsaeda
    qaqaevelyrgivaiyrslgggwqpsagshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5azpB (B:)
    ctvgpdyrtpdtaaakidataskpydrsrfeslwwkqfddptlnqlveqslsgnrdlrva
    farlraaralrddvandrfpvvtsrasadigkgqqpgvtedrvnserydlgldsaweldl
    fgrirrqlessdalseaaeadlqqlqvsliaelvdaygqlrgaqlrekialsnlenqkes
    rqlteqlrdagvgaeldvlradarlaataasvpqlqaeaerarhriatllgqrpeeltvd
    lsprdlpaitkalpigdpgellrrrpdiraaerrlaastadvgvatadlfprvslsgflg
    ftagrgsqigssaarawsvgpsiswaafdlgsvrarlrgakadadaalasyeqqvllale
    esanafsdygkrqerlvslvrqseasraaaqqaairyregttdflvlldaereqlsaeda
    qaqaevelyrgivaiyrslgggwqpsagsh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5azpC (C:)
    ctvgpdyrtpdtaaakidataskpydrsrfeslwwkqfddptlnqlveqslsgnrdlrva
    farlraaralrddvandrfpvvtsrasadigkgqqpgvtedrvnserydlgldsaweldl
    fgrirrqlessdalseaaeadlqqlqvsliaelvdaygqlrgaqlrekialsnlenqkes
    rqlteqlrdagvgaeldvlradarlaataasvpqlqaeaerarhriatllgqrpeeltvd
    lsprdlpaitkalpigdpgellrrrpdiraaerrlaastadvgvatadlfprvslsgflg
    ftagrgsqigssaarawsvgpsiswaafdlgsvrarlrgakadadaalasyeqqvllale
    esanafsdygkrqerlvslvrqseasraaaqqaairyregttdflvlldaereqlsaeda
    qaqaevelyrgivaiyrslgggwqpsagshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5azpC (C:)
    ctvgpdyrtpdtaaakidataskpydrsrfeslwwkqfddptlnqlveqslsgnrdlrva
    farlraaralrddvandrfpvvtsrasadigkgqqpgvtedrvnserydlgldsaweldl
    fgrirrqlessdalseaaeadlqqlqvsliaelvdaygqlrgaqlrekialsnlenqkes
    rqlteqlrdagvgaeldvlradarlaataasvpqlqaeaerarhriatllgqrpeeltvd
    lsprdlpaitkalpigdpgellrrrpdiraaerrlaastadvgvatadlfprvslsgflg
    ftagrgsqigssaarawsvgpsiswaafdlgsvrarlrgakadadaalasyeqqvllale
    esanafsdygkrqerlvslvrqseasraaaqqaairyregttdflvlldaereqlsaeda
    qaqaevelyrgivaiyrslgggwq