PDB entry 5ayf

View 5ayf on RCSB PDB site
Description: Crystal structure of SET7/9 in complex with cyproheptadine
Class: transferase/transferase inhibitor
Keywords: Set domain, methyltransferase, inhibitor, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2015-08-20, released 2016-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-18, with a file datestamp of 2016-05-13.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone-lysine N-methyltransferase SETD7
    Species: Homo sapiens [TaxId:9606]
    Gene: SETD7, KIAA1717, KMT7, SET7, SET9
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WTS6 (Start-262)
      • see sequence details (235-240)
    Domains in SCOPe 2.07: d5ayfa1, d5ayfa2
  • Heterogens: SAM, C7H, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ayfA (A:)
    gssgssgkdnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidge
    miegklatlmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaesli
    ssageglfskvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynh
    vskycaslghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygxxxxxxx
    xxxxxxpewyqvelkafqatqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ayfA (A:)
    hgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmst
    eegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissageglfskva
    vgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycaslghka
    nhsftpnciydmfvhprfgpikcirtlraveadeeltvaygxxxxxxpewyqvelkafqa
    tqqk