PDB entry 5axr

View 5axr on RCSB PDB site
Description: Crystal Structure of Metallo-beta-Lactamase SMB-1 Bound to 2-mercaptoethanesulfonate
Class: hydrolase
Keywords: hydrolase
Deposited on 2015-07-31, released 2016-05-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metallo-beta-lactamase
    Species: Serratia marcescens [TaxId:615]
    Gene: SMB-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5axra_
  • Heterogens: ZN, NA, COM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5axrA (A:)
    qdrdwsspqqpftiygnthyvgtggisavllsspqghilvdgttekgaqvvaaniramgf
    klsdvkyilsthshedhaggisamqkltgatvlagaanvdtlrtgvspksdpqfgslsnf
    pgsakvravadgelvklgplavkahatpghteggitwtwqsceqgkckdvvfadsltavs
    adsyrfsdhpevvaslrgsfeaveklscdiaiaahpevndmwtrqqraakegnsayvdng
    acraiaaagrkrletrlasekr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5axrA (A:)
    rdwsspqqpftiygnthyvgtggisavllsspqghilvdgttekgaqvvaaniramgfkl
    sdvkyilsthshedhaggisamqkltgatvlagaanvdtlrtgvspksdpqfgslsnfpg
    sakvravadgelvklgplavkahatpghteggitwtwqsceqgkckdvvfadsltavsad
    syrfsdhpevvaslrgsfeaveklscdiaiaahpevndmwtrqqraakegnsayvdngac
    raiaaagrkrletrlasek