PDB entry 5axq

View 5axq on RCSB PDB site
Description: Crystal structure of the catalytic domain of PDE10A complexed with highly potent and brain-penetrant PDE10A Inhibitor with 2-oxindole scaffold
Class: hydrolase/hydrolase inhibitor
Keywords: HYDROLASE/HYDROLASE INHIBITOR, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2015-07-31, released 2015-11-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-18, with a file datestamp of 2015-11-13.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5axqa_
  • Chain 'B':
    Compound: cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE10A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5axqb_
  • Heterogens: MG, ZN, 4LP, 4LK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5axqA (A:)
    tseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrf
    imsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfs
    nsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaii
    atdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltand
    iyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepl
    lkacrdnlsqwekvirgeetatwisspsvaqkaaased
    

    Sequence, based on observed residues (ATOM records): (download)
    >5axqA (A:)
    ewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfims
    vkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsy
    lqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatd
    lalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiya
    efwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllka
    crdnlsqwekvirge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5axqB (B:)
    tseewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrf
    imsvkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfs
    nsylqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaii
    atdlalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltand
    iyaefwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepl
    lkacrdnlsqwekvirgeetatwisspsvaqkaaased
    

    Sequence, based on observed residues (ATOM records): (download)
    >5axqB (B:)
    ewqglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfims
    vkknyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsy
    lqkfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatd
    lalyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiya
    efwaegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllka
    crdnlsqwekvirgee