PDB entry 5axo

View 5axo on RCSB PDB site
Description: Crystal Structure of Metallo-beta-Lactamase SMB-1 Bound to Hydrolyzed Meropenem
Class: hydrolase
Keywords: hydrolase
Deposited on 2015-07-31, released 2016-05-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-05-11, with a file datestamp of 2016-05-06.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: metallo-beta-lactamase
    Species: Serratia marcescens [TaxId:615]
    Gene: SMB-1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5axoa_
  • Heterogens: ZN, NA, SO4, TRS, LMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5axoA (A:)
    qdrdwsspqqpftiygnthyvgtggisavllsspqghilvdgttekgaqvvaaniramgf
    klsdvkyilsthshedhaggisamqkltgatvlagaanvdtlrtgvspksdpqfgslsnf
    pgsakvravadgelvklgplavkahatpghteggitwtwqsceqgkckdvvfadsltavs
    adsyrfsdhpevvaslrgsfeaveklscdiaiaahpevndmwtrqqraakegnsayvdng
    acraiaaagrkrletrlasekr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5axoA (A:)
    rdwsspqqpftiygnthyvgtggisavllsspqghilvdgttekgaqvvaaniramgfkl
    sdvkyilsthshedhaggisamqkltgatvlagaanvdtlrtgvspksdpqfgslsnfpg
    sakvravadgelvklgplavkahatpghteggitwtwqsceqgkckdvvfadsltavsad
    syrfsdhpevvaslrgsfeaveklscdiaiaahpevndmwtrqqraakegnsayvdngac
    raiaaagrkrletrlasek