PDB entry 5aww

View 5aww on RCSB PDB site
Description: Precise Resting State of Thermus thermophilus SecYEG
Class: protein transport/immune system
Keywords: translocon, membrane protein, PROTEIN TRANSPORT-IMMUNE SYSTEM complex
Deposited on 2015-07-10, released 2015-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-16, with a file datestamp of 2015-12-11.
Experiment type: XRAY
Resolution: 2.72 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: protein translocase subunit sece
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: secE, TTHA0249
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Putative preprotein translocase, SecG subunit
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: TTHA1784
    Database cross-references and differences (RAF-indexed):
  • Chain 'Y':
    Compound: Protein translocase subunit SecY
    Species: Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) [TaxId:300852]
    Gene: secY, TTHA1672
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SHQ8 (0-End)
      • engineered mutation (1)
      • engineered mutation (251)
    Domains in SCOPe 2.06: d5awwy_
  • Heterogens: OLC, HOH

PDB Chain Sequences:

  • Chain 'E':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >5awwY (Y:)
    mvkafwsalqipelrqrvlftllvlaayrlgafiptpgvdldkiqeflrtaqggvfgiin
    lfsggnferfsifalgimpyitaaiimqilvtvvpaleklskegeegrriinqytriggi
    algafqgfflataflgaeggrfllpgwspgpffwfvvvvtqvagialllwmaeriteygi
    gngtsliifagivvewlpqilrtiglirtgevnlvaflfflafivlafagmaavqqaerr
    ipvqyarkvvggrvyggqatyipiklnaagvipiifaaailqipiflaapfqdnpvlqgi
    anffnptrpsglfievllvilftyvytavqfdpkriaeslreyggfipgirpgeptvkfl
    ehivsrltlwgalflglvtllpqiiqnltgihsiafsgigllivvgvaldtlrqvesqlm
    lrsyegflsrgrlrgrnrhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5awwY (Y:)
    mvkafwsalqipelrqrvlftllvlaayrlgafiptpgvdldkiqeflrtaqggvfgiin
    lfsggnferfsifalgimpyitaaiimqilvtvvpaleklskegeegrriinqytriggi
    algafqgfflataflgaeggrfllpgwspgpffwfvvvvtqvagialllwmaeriteygi
    gngtsliifagivvewlpqilrtiglirtgevnlvaflfflafivlafagmaavqqaerr
    ipvqyarkvvggrvyggqatyipiklnaagvipiifaaailqipiflaapfqdnpvlqgi
    anffnptrpsglfievllvilftyvytavqfdpkriaeslreyggfipgirpgeptvkfl
    ehivsrltlwgalflglvtllpqiiqnltgihsiafsgigllivvgvaldtlrqvesqlm
    lrsy