PDB entry 5awi

View 5awi on RCSB PDB site
Description: Domain-swapped cytochrome cb562 dimer
Class: electron transport
Keywords: Electron transport
Deposited on 2015-07-03, released 2015-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d5awia_
  • Chain 'B':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (97)
      • engineered mutation (100)
    Domains in SCOPe 2.07: d5awib_
  • Heterogens: HEM, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5awiA (A:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemkd
    frhgfdilvgqiddalklanegkvkeaqaaaeqlkttcnachqkyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5awiB (B:)
    adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemkd
    frhgfdilvgqiddalklanegkvkeaqaaaeqlkttcnachqkyr