PDB entry 5avg

View 5avg on RCSB PDB site
Description: The 0.95 angstrom structure of thaumatin crystallized in high-strength agarose hydrogel
Class: plant protein
Keywords: thaumatin, high-strength agarose, hydrogel, PLANT PROTEIN
Deposited on 2015-06-16, released 2015-07-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-19, with a file datestamp of 2020-02-14.
Experiment type: XRAY
Resolution: 0.95 Å
R-factor: N/A
AEROSPACI score: 0.86 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Thaumatin-1
  Species: Thaumatococcus daniellii [TaxId:4621]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02883 (0-205)
  Domains in SCOPe 2.08: d5avga_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5avgA (A:)
  atfeivnrcsytvwaaaskgdaaldaggrqlnsgeswtinvepgtnggkiwartdcyfdd
  sgsgicktgdcggllrckrfgrppttlaefslnqygkdyidisnikgfnvpmnfspttrg
  crgvrcaadivgqcpaklkapgggcndactvfqtseyccttgkcgpteysrffkrlcpda
  fsyvldkpttvtcpgssnyrvtfcpt