PDB entry 5avd

View 5avd on RCSB PDB site
Description: The 0.86 angstrom structure of elastase crystallized in high-strength agarose hydrogel
Class: isomerase
Keywords: elastase, high-strength agarose, hydrogel, ISOMERASE
Deposited on 2015-06-15, released 2015-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-08, with a file datestamp of 2015-07-02.
Experiment type: XRAY
Resolution: 0.86 Å
R-factor: N/A
AEROSPACI score: 0.98 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chymotrypsin-like elastase family member 1
    Species: Sus scrofa [TaxId:9823]
    Gene: CELA1, ELA1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00772 (0-239)
      • see sequence details (65)
    Domains in SCOPe 2.07: d5avda_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5avdA (A:)
    vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
    nlnqnngteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
    lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
    rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn