PDB entry 5av7

View 5av7 on RCSB PDB site
Description: Crystal structure of Calsepa lectin in complex with bisected glycan
Class: sugar binding protein
Keywords: Lectin, glycan, SUGAR BINDING PROTEIN
Deposited on 2015-06-12, released 2016-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-27, with a file datestamp of 2016-04-22.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lectin
    Species: Calystegia sepium [TaxId:47519]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5av7a_
  • Chain 'B':
    Compound: lectin
    Species: Calystegia sepium [TaxId:47519]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5av7b_
  • Chain 'C':
    Compound: lectin
    Species: Calystegia sepium [TaxId:47519]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5av7c_
  • Chain 'D':
    Compound: lectin
    Species: Calystegia sepium [TaxId:47519]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5av7d_
  • Heterogens: MMA, MAN, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5av7A (A:)
    vpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitvg
    gggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtpf
    ssanvvgneivgflgrsgyyvdaigtynrhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5av7A (A:)
    vpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkdtitvggggpd
    sitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtpfssane
    ivgflgrsgyyvdaigtynrh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5av7B (B:)
    vpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitvg
    gggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtpf
    ssanvvgneivgflgrsgyyvdaigtynrhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5av7B (B:)
    vpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitvg
    gggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtpf
    ssanvneivgflgrsgyyvdaigtynrh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5av7C (C:)
    vpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitvg
    gggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtpf
    ssanvvgneivgflgrsgyyvdaigtynrhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5av7C (C:)
    vpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitvg
    gggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtpf
    ssanvneivgflgrsgyyvdaigtynrh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5av7D (D:)
    vpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkadgskdtitvg
    gggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtpf
    ssanvvgneivgflgrsgyyvdaigtynrhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5av7D (D:)
    vpmdtisgpwgnnggnfwsfrpvnkinqivisyggggnnpialtfsstkagskdtitvgg
    ggpdsitgtemvnigtdeyltgisgtfgiyldnnvlrsitfttnlkahgpygqkvgtpfs
    sanvneivgflgrsgyyvdaigtynrh