PDB entry 5arl

View 5arl on RCSB PDB site
Description: crystal structure of porcine RNase 4 D80A mutant in complex with dCMP
Class: hydrolase
Keywords: ribonuclease 4, hydrolase, RNA degradation
Deposited on 2015-09-25, released 2016-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-23, with a file datestamp of 2016-03-18.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease 4
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15468 (15-133)
      • expression tag (13-14)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d5arla1, d5arla2
  • Chain 'B':
    Compound: ribonuclease 4
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15468 (15-133)
      • expression tag (13-14)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d5arlb1, d5arlb2
  • Chain 'C':
    Compound: ribonuclease 4
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15468 (15-133)
      • expression tag (14)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d5arlc1, d5arlc2
  • Chain 'D':
    Compound: ribonuclease 4
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15468 (15-133)
      • expression tag (14)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d5arld1, d5arld2
  • Heterogens: DCM

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5arlA (A:)
    mahhhhhhvddddkmqdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntf
    ihediwnirsicstsniqckngqmnchegvvkvtacretgssrapncryramastrrvvi
    acegnpevpvhfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5arlA (A:)
    kmqdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntfihediwnirsics
    tsniqckngqmnchegvvkvtacretgssrapncryramastrrvviacegnpevpvhfd
    k
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5arlB (B:)
    mahhhhhhvddddkmqdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntf
    ihediwnirsicstsniqckngqmnchegvvkvtacretgssrapncryramastrrvvi
    acegnpevpvhfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5arlB (B:)
    kmqdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntfihediwnirsics
    tsniqckngqmnchegvvkvtacretgssrapncryramastrrvviacegnpevpvhfd
    k
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5arlC (C:)
    mahhhhhhvddddkmqdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntf
    ihediwnirsicstsniqckngqmnchegvvkvtacretgssrapncryramastrrvvi
    acegnpevpvhfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5arlC (C:)
    mqdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntfihediwnirsicst
    sniqckngqmnchegvvkvtacretgssrapncryramastrrvviacegnpevpvhfdk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5arlD (D:)
    mahhhhhhvddddkmqdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntf
    ihediwnirsicstsniqckngqmnchegvvkvtacretgssrapncryramastrrvvi
    acegnpevpvhfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5arlD (D:)
    mqdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntfihediwnirsicst
    sniqckngqmnchegvvkvtacretgssrapncryramastrrvviacegnpevpvhfdk