PDB entry 5ark

View 5ark on RCSB PDB site
Description: crystal structure of porcine RNase 4 in complex with dUMP
Class: hydrolase
Keywords: ribonuclease 4, hydrolase, RNA degradation
Deposited on 2015-09-25, released 2016-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-23, with a file datestamp of 2016-03-18.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease 4
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5arka_
  • Chain 'B':
    Compound: ribonuclease 4
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5arkb_
  • Chain 'C':
    Compound: ribonuclease 4
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5arkc_
  • Chain 'D':
    Compound: ribonuclease 4
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5arkd_
  • Heterogens: UMP, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5arkA (A:)
    mahhhhhhvddddkmqdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntf
    ihediwnirsicstsniqckngqmnchegvvkvtdcretgssrapncryramastrrvvi
    acegnpevpvhfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5arkA (A:)
    qdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntfihediwnirsicsts
    niqckngqmnchegvvkvtdcretgssrapncryramastrrvviacegnpevpvhfdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5arkB (B:)
    mahhhhhhvddddkmqdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntf
    ihediwnirsicstsniqckngqmnchegvvkvtdcretgssrapncryramastrrvvi
    acegnpevpvhfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5arkB (B:)
    qdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntfihediwnirsicsts
    niqckngqmnchegvvkvtdcretgssrapncryramastrrvviacegnpevpvhfdk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5arkC (C:)
    mahhhhhhvddddkmqdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntf
    ihediwnirsicstsniqckngqmnchegvvkvtdcretgssrapncryramastrrvvi
    acegnpevpvhfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5arkC (C:)
    qdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntfihediwnirsicsts
    niqckngqmnchegvvkvtdcretgssrapncryramastrrvviacegnpevpvhfdk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5arkD (D:)
    mahhhhhhvddddkmqdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntf
    ihediwnirsicstsniqckngqmnchegvvkvtdcretgssrapncryramastrrvvi
    acegnpevpvhfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5arkD (D:)
    qdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntfihediwnirsicsts
    niqckngqmnchegvvkvtdcretgssrapncryramastrrvviacegnpevpvhfdk