PDB entry 5arj

View 5arj on RCSB PDB site
Description: crystal structure of porcine RNase 4 D80A mutant
Class: hydrolase
Keywords: hydrolase, RNA degradation
Deposited on 2015-09-25, released 2016-01-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-03-16, with a file datestamp of 2016-03-11.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease 4
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15468 (15-133)
      • expression tag (14)
      • engineered mutation (94)
    Domains in SCOPe 2.08: d5arja1, d5arja2
  • Chain 'B':
    Compound: ribonuclease 4
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15468 (15-133)
      • engineered mutation (94)
    Domains in SCOPe 2.08: d5arjb_
  • Chain 'C':
    Compound: ribonuclease 4
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15468 (15-133)
      • expression tag (13-14)
      • engineered mutation (94)
    Domains in SCOPe 2.08: d5arjc1, d5arjc2
  • Chain 'D':
    Compound: ribonuclease 4
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15468 (15-133)
      • expression tag (13-14)
      • engineered mutation (94)
    Domains in SCOPe 2.08: d5arjd1, d5arjd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5arjA (A:)
    mahhhhhhvddddkmqdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntf
    ihediwnirsicstsniqckngqmnchegvvkvtacretgssrapncryramastrrvvi
    acegnpevpvhfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5arjA (A:)
    mqdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntfihediwnirsicst
    sniqckngqmnchegvvkvtacretgssrapncryramastrrvviacegnpevpvhfdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5arjB (B:)
    mahhhhhhvddddkmqdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntf
    ihediwnirsicstsniqckngqmnchegvvkvtacretgssrapncryramastrrvvi
    acegnpevpvhfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5arjB (B:)
    qdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntfihediwnirsicsts
    niqckngqmnchegvvkvtacretgssrapncryramastrrvviacegnpevpvhfdk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5arjC (C:)
    mahhhhhhvddddkmqdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntf
    ihediwnirsicstsniqckngqmnchegvvkvtacretgssrapncryramastrrvvi
    acegnpevpvhfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5arjC (C:)
    kmqdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntfihediwnirsics
    tsniqckngqmnchegvvkvtacretgssrapncryramastrrvviacegnpevpvhfd
    k
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5arjD (D:)
    mahhhhhhvddddkmqdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntf
    ihediwnirsicstsniqckngqmnchegvvkvtacretgssrapncryramastrrvvi
    acegnpevpvhfdk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5arjD (D:)
    kmqdrmyqrflrqhvdpdatggndaycnlmmqrrkmtshyckrfntfihediwnirsics
    tsniqckngqmnchegvvkvtacretgssrapncryramastrrvviacegnpevpvhfd
    k