PDB entry 5aqp

View 5aqp on RCSB PDB site
Description: Fragment-based screening of HSP70 sheds light on the functional role of ATP-binding site residues
Class: chaperone
Keywords: heat shock protein, hsp70, hsp72, hsc70, ATPase, bag1, chaperone, fragment
Deposited on 2015-09-22, released 2016-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock cognate 71 kDa protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11142 (5-385)
      • expression tag (4)
    Domains in SCOPe 2.07: d5aqpa1, d5aqpa2, d5aqpa3
  • Chain 'B':
    Compound: BAG family molecular chaperone regulator 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99933 (5-End)
      • expression tag (4)
  • Chain 'C':
    Compound: Heat shock cognate 71 kDa protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aqpc1, d5aqpc2
  • Chain 'D':
    Compound: BAG family molecular chaperone regulator 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99933 (5-End)
      • expression tag (3-4)
  • Chain 'E':
    Compound: Heat shock cognate 71 kDa protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aqpe1, d5aqpe2
  • Chain 'F':
    Compound: BAG family molecular chaperone regulator 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99933 (5-End)
      • expression tag (2-4)
  • Heterogens: 1LQ, GOL, DMS, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5aqpA (A:)
    gplgsmskgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaa
    knqvamnptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfy
    peevssmvltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriine
    ptaaaiaygldkkvgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdn
    rmvnhfiaefkrkhkkdisenkravrrlrtacerakrtlssstqasieidslyegidfyt
    sitrarfeelnadlfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffn
    gkelnksinpdeavaygaavqaails
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aqpA (A:)
    smskgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqv
    amnptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeev
    ssmvltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaa
    aiaygldkkvgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvn
    hfiaefkrkhkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitr
    arfeelnadlfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkel
    nksinpdeavaygaavqaails
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5aqpC (C:)
    gplgsmskgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaa
    knqvamnptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfy
    peevssmvltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriine
    ptaaaiaygldkkvgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdn
    rmvnhfiaefkrkhkkdisenkravrrlrtacerakrtlssstqasieidslyegidfyt
    sitrarfeelnadlfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffn
    gkelnksinpdeavaygaavqaails
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aqpC (C:)
    mskgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqva
    mnptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevs
    smvltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaa
    iaygldkkvgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnh
    fiaefkrkhkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitra
    rfeelnadlfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkeln
    ksinpdeavaygaavqaails
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5aqpE (E:)
    gplgsmskgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaa
    knqvamnptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfy
    peevssmvltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriine
    ptaaaiaygldkkvgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdn
    rmvnhfiaefkrkhkkdisenkravrrlrtacerakrtlssstqasieidslyegidfyt
    sitrarfeelnadlfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffn
    gkelnksinpdeavaygaavqaails
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aqpE (E:)
    mskgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqva
    mnptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevs
    smvltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaa
    iaygldkkvgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnh
    fiaefkrkhkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitra
    rfeelnadlfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkeln
    ksinpdeavaygaavqaails
    

  • Chain 'F':
    No sequence available.