PDB entry 5aqe

View 5aqe on RCSB PDB site
Description: Cooperative bio-metallic selectivity in a tailored protease enables creation of a C-C cross-coupling Heckase
Class: hydrolase
Keywords: hydrolase, protease, subtilisin, catalysis, palladium, metalloenzyme, heck reaction, cross-coupling
Deposited on 2015-09-22, released 2015-10-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-10-07, with a file datestamp of 2015-10-02.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Subtilisin Savinase
    Species: Bacillus lentus [TaxId:1467]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5aqea_
  • Heterogens: VOD, SO4, CA, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqeA (A:)
    aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
    ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsvssiaqglewagnngmhva
    nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
    asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
    rnhlkntatslgstnlygsglvnaeaatr