PDB entry 5aqd

View 5aqd on RCSB PDB site
Description: Crystal structure of Phormidium Phycoerythrin at pH 8.5
Class: photosynthesis
Keywords: photosynthesis, phycobilisome protein, phycoerythrin alpha chain, phycoerythrin beta chain, peb chromophore, protein-chromophore linkage
Deposited on 2015-09-22, released 2016-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phycoerythrin alpha subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-159)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5aqda_
  • Chain 'B':
    Compound: Phycoerythrin alpha subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-159)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5aqdb_
  • Chain 'C':
    Compound: Phycoerythrin alpha subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-159)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5aqdc_
  • Chain 'D':
    Compound: Phycoerythrin alpha subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-159)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5aqdd_
  • Chain 'E':
    Compound: Phycoerythrin alpha subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-159)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5aqde_
  • Chain 'F':
    Compound: Phycoerythrin alpha subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-159)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5aqdf_
  • Chain 'G':
    Compound: Phycoerythrin alpha subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-159)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5aqdg_
  • Chain 'H':
    Compound: Phycoerythrin alpha subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-159)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5aqdh_
  • Chain 'I':
    Compound: Phycoerythrin alpha subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-159)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5aqdi_
  • Chain 'J':
    Compound: Phycoerythrin alpha subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-159)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5aqdj_
  • Chain 'K':
    Compound: Phycoerythrin alpha subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-159)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5aqdk_
  • Chain 'L':
    Compound: Phycoerythrin alpha subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0E3W010 (0-159)
      • see remark 999 (160-163)
    Domains in SCOPe 2.07: d5aqdl_
  • Chain 'M':
    Compound: phycoerythrin beta subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aqdm_
  • Chain 'N':
    Compound: phycoerythrin beta subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aqdn_
  • Chain 'O':
    Compound: phycoerythrin beta subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aqdo_
  • Chain 'P':
    Compound: phycoerythrin beta subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aqdp_
  • Chain 'Q':
    Compound: phycoerythrin beta subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aqdq_
  • Chain 'R':
    Compound: phycoerythrin beta subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aqdr_
  • Chain 'S':
    Compound: phycoerythrin beta subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aqds_
  • Chain 'T':
    Compound: phycoerythrin beta subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aqdt_
  • Chain 'U':
    Compound: phycoerythrin beta subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aqdu_
  • Chain 'V':
    Compound: phycoerythrin beta subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aqdv_
  • Chain 'W':
    Compound: phycoerythrin beta subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aqdw_
  • Chain 'X':
    Compound: phycoerythrin beta subunit
    Species: Phormidium rubidum A09DM [TaxId:865859]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aqdx_
  • Heterogens: PEB, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdA (A:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdB (B:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdC (C:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdD (D:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdE (E:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdF (F:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdG (G:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdH (H:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdI (I:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdJ (J:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdK (K:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdL (L:)
    mksvvttviaaadaagrfpsssdlesvqgsiqrsaarleaaeklagnidavaqeaynaci
    qkypylnnsgeanstdtfkakclrdvkhymrliqyslvvggtgpldewgiagqrevyral
    glptapyvealsfarnrgcaprdmsaqalteynalldyainsls
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdM (M:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdN (N:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdO (O:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdP (P:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdQ (Q:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdR (R:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdS (S:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdT (T:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals
    

  • Chain 'U':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdU (U:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdV (V:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdW (W:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals
    

  • Chain 'X':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5aqdX (X:)
    mldafsravvqadastsvvadmgalkqfiaegnrrldavnaiasnascmvsdavagmice
    nqgliqaggncypnrrmaaclrdaeiilryvtyallagdasvlddrclnglketyaalgv
    pttstvravqimkaqaaahikdtpsearaggklrkmgspvvedrcaslvaeassyfdrvi
    sals