PDB entry 5aoh

View 5aoh on RCSB PDB site
Description: Crystal Structure of CarF
Class: unknown function
Keywords: unknown function, carbapenem resistance, antibiotic resistance, fge homologue
Deposited on 2015-09-10, released 2017-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-19, with a file datestamp of 2017-07-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carf
    Species: SERRATIA SP. ATCC 39006 [TaxId:104623]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aoha_
  • Chain 'B':
    Compound: carf
    Species: SERRATIA SP. ATCC 39006 [TaxId:104623]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aohb_
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5aohA (A:)
    eilpidevnvdggdfyvglvfgkedyaahanthltpfsimrtevtyhqyqalqawaetrg
    yqisggcngatfedcwpsekdggrhpvtnvswwdavifanalsaqhnlqpyyvtadgqal
    kippeegtdrgirenpqasgyrlptlaewqvaarggnkglsdgtygsryagkdqpasvan
    lpvsgtqtfstlpvaskqpnslglydmsgnvsewlnenyavkggkkmyyfcggsymdrvg
    slascdvhtpgfamsdigfrlvrpiddkhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aohA (A:)
    ilpidevnvdggdfyvglvfgkedyaahanthltpfsimrtevtyhqyqalqawaetrgy
    qisggcngatfedcwpsekdggrhpvtnvswwdavifanalsaqhnlqpyyvtadgqalk
    ippeegtdrgirenpqasgyrlptlaewqvaarggnkglsdgtygsryagkdqpasvanl
    pvsgtqtfstlpvaskqpnslglydmsgnvsewlnenyavkggkkmyyfcggsymdrvgs
    lascdvhtpgfamsdigfrlvrpid
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5aohB (B:)
    eilpidevnvdggdfyvglvfgkedyaahanthltpfsimrtevtyhqyqalqawaetrg
    yqisggcngatfedcwpsekdggrhpvtnvswwdavifanalsaqhnlqpyyvtadgqal
    kippeegtdrgirenpqasgyrlptlaewqvaarggnkglsdgtygsryagkdqpasvan
    lpvsgtqtfstlpvaskqpnslglydmsgnvsewlnenyavkggkkmyyfcggsymdrvg
    slascdvhtpgfamsdigfrlvrpiddkhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aohB (B:)
    ilpidevnvdggdfyvglvfgkedyaahanthltpfsimrtevtyhqyqalqawaetrgy
    qisggcngatfedcwpsekdggrhpvtnvswwdavifanalsaqhnlqpyyvtadgqalk
    ippeegirenpqasgyrlptlaewqvaarggnkglsdgtygsryagkdqpasvanlpvsg
    tqtfstlpvaskqpnslglydmsgnvsewlnenyavkggkkmyyfcggsymdrvgslasc
    dvhtpgfamsdigfrlvrpid