PDB entry 5anr

View 5anr on RCSB PDB site
Description: 4E-T - DDX6 - CNOT1 complex
Class: RNA binding protein
Keywords: RNA binding protein
Deposited on 2015-09-08, released 2015-10-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-10-21, with a file datestamp of 2015-10-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CCR4-NOT transcription complex subunit 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: probable ATP-dependent RNA helicase ddx6
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5anrb1, d5anrb2
  • Chain 'C':
    Compound: eukaryotic translation initiation factor 4e transporter
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5anrB (B:)
    rsmgnefedyclkrellmgifemgwekpspiqeesipialsgrdilarakngtgksgayl
    ipllerldlkkdniqamvivptrelalqvsqiciqvskhmggakvmattggtnlrddimr
    lddtvhvviatpgrildlikkgvakvdhvqmivldeadkllsqdfvqimediiltlpknr
    qillysatfplsvqkfmnshlqkpyeinlmeeltlkgvtqyyayvterqkvhclntlfsr
    lqinqsiifcnssqrvellakkisqlgyscfyihakmrqehrnrvfhdfrnglcrnlvct
    dlftrgidiqavnvvinfdfpklaetylhrigrsgrfghlglainlityddrfnlksiee
    qlgteikpipsnidksly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5anrB (B:)
    gnefedyclkrellmgifemgwekpspiqeesipialsgrdilarakngtgksgaylipl
    lerldlkkdniqamvivptrelalqvsqiciqvskhmggakvmattggtnlrddimrldd
    tvhvviatpgrildlikkgvakvdhvqmivldeadkllsqdfvqimediiltlpknrqil
    lysatfplsvqkfmnshlqkpyeinlmeeltlkgvtqyyayvterqkvhclntlfsrlqi
    nqsiifcnssqrvellakkisqlgyscfyihakmrqehrnrvfhdfrnglcrnlvctdlf
    diqavnvvinfdfpklaetylhrigrsglglainlityddrfnlksieeqlgteikpips
    

  • Chain 'C':
    No sequence available.