PDB entry 5ajh

View 5ajh on RCSB PDB site
Description: Crystal structure of Fusarium oxysporum cutinase
Class: hydrolase
Keywords: hydrolase, alpha/beta hydrolase fold, esterase, pet modification
Deposited on 2015-02-24, released 2015-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-07, with a file datestamp of 2015-10-02.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cutinase
    Species: FUSARIUM OXYSPORUM F. SP. RAPHANI [TaxId:1089458]
    Database cross-references and differences (RAF-indexed):
    • Uniprot X0BTD8 (Start-214)
      • expression tag (215-218)
      • cloning artefact (145)
    Domains in SCOPe 2.07: d5ajha1, d5ajha2
  • Chain 'B':
    Compound: cutinase
    Species: FUSARIUM OXYSPORUM F. SP. RAPHANI [TaxId:1089458]
    Database cross-references and differences (RAF-indexed):
    • Uniprot X0BTD8 (Start-214)
      • expression tag (215-216)
      • cloning artefact (145)
    Domains in SCOPe 2.07: d5ajhb1, d5ajhb2
  • Chain 'C':
    Compound: cutinase
    Species: FUSARIUM OXYSPORUM F. SP. RAPHANI [TaxId:1089458]
    Database cross-references and differences (RAF-indexed):
    • Uniprot X0BTD8
      • cloning artefact (145)
    Domains in SCOPe 2.07: d5ajhc_
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ajhA (A:)
    mlpagqdaaalearqlggsitrndlangnsgscpgvifiyargstesgnlgtlgprvask
    leakygkngvwiqgvggayratlgdnalprgtssaairemlghfsdanqkcpdavliagg
    ysqgaalaaasvtdvdagirekiagavlfgytknlqnrgkipsypedrtkvfcntgdlvc
    tgslivaaphlayqsaasgaapefliqkadaagaaaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ajhA (A:)
    sitrndlangnsgscpgvifiyargstesgnlgtlgprvaskleakygkngvwiqgvgga
    yratlgdnalprgtssaairemlghfsdanqkcpdavliaggysqgaalaaasvtdvdag
    irekiagavlfgytknlqnrgkipsypedrtkvfcntgdlvctgslivaaphlayqsaas
    gaapefliqkadaagaaaaal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ajhB (B:)
    mlpagqdaaalearqlggsitrndlangnsgscpgvifiyargstesgnlgtlgprvask
    leakygkngvwiqgvggayratlgdnalprgtssaairemlghfsdanqkcpdavliagg
    ysqgaalaaasvtdvdagirekiagavlfgytknlqnrgkipsypedrtkvfcntgdlvc
    tgslivaaphlayqsaasgaapefliqkadaagaaaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ajhB (B:)
    sitrndlangnsgscpgvifiyargstesgnlgtlgprvaskleakygkngvwiqgvgga
    yratlgdnalprgtssaairemlghfsdanqkcpdavliaggysqgaalaaasvtdvdag
    irekiagavlfgytknlqnrgkipsypedrtkvfcntgdlvctgslivaaphlayqsaas
    gaapefliqkadaagaaaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ajhC (C:)
    mlpagqdaaalearqlggsitrndlangnsgscpgvifiyargstesgnlgtlgprvask
    leakygkngvwiqgvggayratlgdnalprgtssaairemlghfsdanqkcpdavliagg
    ysqgaalaaasvtdvdagirekiagavlfgytknlqnrgkipsypedrtkvfcntgdlvc
    tgslivaaphlayqsaasgaapefliqkadaagaaaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ajhC (C:)
    sitrndlangnsgscpgvifiyargstesgnlgtlgprvaskleakygkngvwiqgvgga
    yratlgdnalprgtssaairemlghfsdanqkcpdavliaggysqgaalaaasvtdvdag
    irekiagavlfgytknlqnrgkipsypedrtkvfcntgdlvctgslivaaphlayqsaas
    gaapefliqkadaaga