PDB entry 5ais

View 5ais on RCSB PDB site
Description: Complex of human hematopoietic prostagandin D2 synthase (hH-PGDS) in complex with an active site inhibitor.
Class: transferase
Keywords: transferase, prostaglandin d2 synthase, pgds inhibitors, indole, focused screening, hit validation
Deposited on 2015-02-17, released 2015-06-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-06-10, with a file datestamp of 2015-06-05.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5aisa1, d5aisa2
  • Chain 'B':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5aisb1, d5aisb2
  • Chain 'C':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5aisc1, d5aisc2
  • Chain 'D':
    Compound: hematopoietic prostaglandin d synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5aisd1, d5aisd2
  • Heterogens: CWC, GSH, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5aisA (A:)
    hpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdglt
    lhqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnell
    tynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkk
    vqaipavanwikrrpqtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aisA (A:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5aisB (B:)
    hpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdglt
    lhqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnell
    tynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkk
    vqaipavanwikrrpqtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aisB (B:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5aisC (C:)
    hpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdglt
    lhqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnell
    tynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkk
    vqaipavanwikrrpqtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aisC (C:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5aisD (D:)
    hpnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdglt
    lhqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnell
    tynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkk
    vqaipavanwikrrpqtkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aisD (D:)
    pnykltyfnmrgraeiiryifayldiqyedhrieqadwpeikstlpfgkipilevdgltl
    hqslaiaryltkntdlagntemeqchvdaivdtlddfmscfpwaekkqdvkeqmfnellt
    ynaphlmqdldtylggrewlignsvtwadfyweicsttllvfkpdlldnhprlvtlrkkv
    qaipavanwikrrpqtkl