PDB entry 5ain

View 5ain on RCSB PDB site
Description: Varenicline Interactions at the 5HT3 Receptor Ligand Binding Site are Revealed by 5HTBP
Class: serotonin binding protein
Keywords: serotonin binding protein
Deposited on 2015-02-16, released 2015-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-30, with a file datestamp of 2016-03-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (0-End)
      • conflict (40)
      • conflict (54)
      • conflict (91)
      • conflict (135)
      • conflict (139-140)
    Domains in SCOPe 2.07: d5aina_
  • Chain 'B':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (0-End)
      • conflict (40)
      • conflict (54)
      • conflict (91)
      • conflict (135)
      • conflict (139-140)
    Domains in SCOPe 2.07: d5ainb_
  • Chain 'C':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (0-End)
      • conflict (40)
      • conflict (54)
      • conflict (91)
      • conflict (135)
      • conflict (139-140)
    Domains in SCOPe 2.07: d5ainc_
  • Chain 'D':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (0-End)
      • conflict (40)
      • conflict (54)
      • conflict (91)
      • conflict (135)
      • conflict (139-140)
    Domains in SCOPe 2.07: d5aind_
  • Chain 'E':
    Compound: Soluble acetylcholine receptor
    Species: Aplysia californica [TaxId:6500]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WSF8 (0-End)
      • conflict (40)
      • conflict (54)
      • conflict (91)
      • conflict (135)
      • conflict (139-140)
    Domains in SCOPe 2.07: d5aine_
  • Heterogens: QMR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ainA (A:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditayestrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcaltfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerragngff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ainA (A:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditayestrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcaltfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ainB (B:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditayestrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcaltfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerragngff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ainB (B:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditayestrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcaltfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5ainC (C:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditayestrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcaltfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerragngff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ainC (C:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditayestrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcaltfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5ainD (D:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditayestrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcaltfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerragngff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ainD (D:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditayestrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcaltfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5ainE (E:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditayestrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcaltfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrerragngff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ainE (E:)
    qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyerqrwkl
    nslmwdpneygnitdfrtsaadiwtpditayestrpvqvlspqiavvthdgsvmfipaqr
    lsfmcdptgvdseegvtcaltfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
    rqvqhysccpepyidvnlvvkfrer