PDB entry 5aie

View 5aie on RCSB PDB site
Description: Not4 ring domain in complex Ubc4
Class: ligase
Keywords: ligase, signaling protein, not4 ring domain, ubc4, e2-e3 ligase
Deposited on 2015-02-12, released 2015-04-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-27, with a file datestamp of 2015-05-22.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: general negative regulator of transcription subunit 4
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P34909 (3-End)
      • expression tag (2)
    Domains in SCOPe 2.07: d5aiea1, d5aiea2
  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2 4
    Species: Saccharomyces cerevisiae [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15731 (10-157)
      • expression tag (8-9)
    Domains in SCOPe 2.07: d5aieb1, d5aieb2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5aieA (A:)
    rsmedycplciepmditdknffpcpcgyqicqfcynnirqnpelngrcpacrrkydd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aieA (A:)
    medycplciepmditdknffpcpcgyqicqfcynnirqnpelngrcpacrrkyd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5aieB (B:)
    tgstgstetgmssskriakelsdlerdpptscsagpvgddlyhwqasimgpadspyaggv
    fflsihfptdypfkppkisfttkiyhpninangnicldilkdqwspaltlskvllsicsl
    ltdanpddplvpeiahiyktdrpkyeatarewtkkyav
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aieB (B:)
    tgmssskriakelsdlerdpptscsagpvgddlyhwqasimgpadspyaggvfflsihfp
    tdypfkppkisfttkiyhpninangnicldilkdqwspaltlskvllsicslltdanpdd
    plvpeiahiyktdrpkyeatarewtkkyav