PDB entry 5ai3

View 5ai3 on RCSB PDB site
Description: X-ray structure of 113Cd-substituted Perdeuterated Pyrococcus furiosus rubredoxin to 1.02A resolution at 295K in a quartz capillary
Class: electron transport
Keywords: electron transport, perdeuterated
Deposited on 2015-02-11, released 2016-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-08-24, with a file datestamp of 2016-08-18.
Experiment type: XRAY
Resolution: 1.02 Å
R-factor: N/A
AEROSPACI score: 0.82 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rubredoxin
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5ai3a_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5ai3A (A:)
    makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled