PDB entry 5ai2

View 5ai2 on RCSB PDB site
Description: Anomalous Neutron phased crystal structure of 113Cd-substituted Perdeuterated Pyrococcus furiosus rubredoxin to 1.75A resolution at 295K
Class: electron transport
Keywords: electron transport, neutron anomalous phasing, perdeuterated, pyrococcus furiosus, rubredoxin, cadmium
Deposited on 2015-02-11, released 2016-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-08-24, with a file datestamp of 2016-08-18.
Experiment type: NEUT
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: rubredoxin
  Species: Pyrococcus furiosus [TaxId:2261]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P24297 (0-53)
  Domains in SCOPe 2.08: d5ai2a_
• Heterogens: CD, D8U, DOD

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5ai2A (A:)
  makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled