SCOPe 2.08: Structural Classification of Proteins

PDB entry 5ahw

View 5ahw on RCSB PDB site
Description: Crystal structure of universal stress protein MSMEG_3811 in complex with cAMP
Class: signaling protein
Keywords: signaling protein, rv1636 homolog, usp type 1 homodimer, walker a-like motif, ATP-binding motif
Deposited on 2015-02-10, released 2015-04-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Universal stress protein
Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
Database cross-references and differences (RAF-indexed):
- Uniprot A0QYW6 (Start-146)
Domains in SCOPe 2.08: d5ahwa_
Chain 'B':
Compound: Universal stress protein
Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
Database cross-references and differences (RAF-indexed):
- Uniprot A0QYW6 (Start-146)
Domains in SCOPe 2.08: d5ahwb_
Chain 'C':
Compound: Universal stress protein
Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
Database cross-references and differences (RAF-indexed):
- Uniprot A0QYW6 (Start-146)
Domains in SCOPe 2.08: d5ahwc_
Chain 'D':
Compound: Universal stress protein
Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
Database cross-references and differences (RAF-indexed):
- Uniprot A0QYW6 (Start-146)
Domains in SCOPe 2.08: d5ahwd_
Chain 'E':
Compound: Universal stress protein
Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
Database cross-references and differences (RAF-indexed):
- Uniprot A0QYW6 (Start-146)
Domains in SCOPe 2.08: d5ahwe_
Chain 'F':
Compound: Universal stress protein
Species: Mycobacterium smegmatis str. MC2 155 [TaxId:246196]
Database cross-references and differences (RAF-indexed):
- Uniprot A0QYW6 (Start-146)
Domains in SCOPe 2.08: d5ahwf_
Heterogens: CMP, SO4, CL, POG, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>5ahwA (A:)
msayqtvvvgtdgsdsslravdragqiaaasnakliiatayfpqsedsraadvlkdegyk
magnapiyailreandrakaagatdieerpvvgapvdalveladevkadllvvgnvglst
iagrllgsvpanvarrsktdvlivhts