PDB entry 5afw

View 5afw on RCSB PDB site
Description: Assembly of methylated LSD1 and CHD1 drives AR-dependent transcription and translocation
Class: hydrolase
Keywords: hydrolase, lsd1k114me2, androgen receptor, chd1, g9a, prostate cancer, tmprrs2-erg
Deposited on 2015-01-26, released 2016-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-02, with a file datestamp of 2016-02-26.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromodomain-helicase-DNA-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5afwa1, d5afwa2
  • Chain 'B':
    Compound: Lysine-specific histone demethylase 1A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EDO, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5afwA (A:)
    efetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqylikwkgwshih
    ntweteetlkqqnvrgmkkldnykkkdqetkrwlknaspedveyyncqqeltddlhkqyq
    iveriiahsnqksaagypdyyckwqglpysecswedgaliskkfqacideyfsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5afwA (A:)
    efetierfmdcrigrkgatgatttiyaveadgdpnagfeknkepgeiqylikwkgwshih
    ntweteetlkqqnvrgmkkldnykkkdqetkrwyncqqeltddlhkqyqiveriiahsnq
    ksaagypdyyckwqglpysecswedgaliskkfqacideyfsr
    

  • Chain 'B':
    No sequence available.