PDB entry 5afm

View 5afm on RCSB PDB site
Description: alpha7-AChBP in complex with lobeline and fragment 4
Class: transport protein
Keywords: transport protein, pentameric ligand-gated ion channels, cys-loop receptor, nicotinic acetylcholine receptor, allosteric modulation, drug discovery
Deposited on 2015-01-22, released 2015-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-27, with a file datestamp of 2015-05-22.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5AFM (0-204)
    Domains in SCOPe 2.06: d5afma_
  • Chain 'B':
    Compound: acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7
    Species: HOMO SAPIENS, LYMNAEA STAGNALIS [TaxId:9606, 6523, 9606, 6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5AFM (0-206)
    Domains in SCOPe 2.06: d5afmb_
  • Chain 'C':
    Compound: acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5AFM (0-204)
    Domains in SCOPe 2.06: d5afmc_
  • Chain 'D':
    Compound: acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5AFM (0-204)
    Domains in SCOPe 2.06: d5afmd_
  • Chain 'E':
    Compound: acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5AFM (0-204)
    Domains in SCOPe 2.06: d5afme_
  • Heterogens: NAG, L0B, GOL, 9Z0, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5afmA (A:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
    dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5afmB (B:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
    dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkgrs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5afmC (C:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
    dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5afmD (D:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
    dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5afmE (E:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
    dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg