PDB entry 5afj

View 5afj on RCSB PDB site
Description: alpha7-AChBP in complex with lobeline and fragment 1
Class: transport protein
Keywords: transport protein, pentameric ligand-gated ion channels, cys-loop receptor, nicotinic acetylcholine receptor, allosteric modulation
Deposited on 2015-01-22, released 2015-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-05-27, with a file datestamp of 2015-05-22.
Experiment type: XRAY
Resolution: 2.22 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5AFJ (Start-204)
    Domains in SCOPe 2.06: d5afja_
  • Chain 'B':
    Compound: acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5AFJ (0-204)
    Domains in SCOPe 2.06: d5afjb_
  • Chain 'C':
    Compound: acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5AFJ (0-204)
    Domains in SCOPe 2.06: d5afjc_
  • Chain 'D':
    Compound: acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5AFJ (0-204)
    Domains in SCOPe 2.06: d5afjd_
  • Chain 'E':
    Compound: acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5AFJ (0-204)
    Domains in SCOPe 2.06: d5afje_
  • Heterogens: NAG, 42R, L0B, GOL, BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5afjA (A:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
    dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5afjA (A:)
    efqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswtd
    hylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsir
    qrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrs
    erfyecckepypdvtftvtfrkkg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5afjB (B:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
    dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5afjC (C:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
    dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5afjD (D:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
    dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5afjE (E:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
    dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg