PDB entry 5afh

View 5afh on RCSB PDB site
Description: alpha7-AChBP in complex with lobeline
Class: transport protein
Keywords: transport protein, pentameric ligand-gated ion channels, cys-loop receptor, nicotinic acetylcholine receptor, allosteric modulation, drug discovery
Deposited on 2015-01-22, released 2015-05-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-06-10, with a file datestamp of 2015-06-05.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5AFH (0-204)
    Domains in SCOPe 2.06: d5afha_
  • Chain 'B':
    Compound: acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5AFH (0-204)
    Domains in SCOPe 2.06: d5afhb_
  • Chain 'C':
    Compound: acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5AFH (0-204)
    Domains in SCOPe 2.06: d5afhc_
  • Chain 'D':
    Compound: acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5AFH (0-204)
    Domains in SCOPe 2.06: d5afhd_
  • Chain 'E':
    Compound: acetylcholine-binding protein, neuronal acetylcholine receptor subunit alpha-7
    Species: Homo sapiens, Lymnaea stagnalis [TaxId:9606, 6523]
    Database cross-references and differences (RAF-indexed):
    • PDB 5AFH (0-204)
    Domains in SCOPe 2.06: d5afhe_
  • Heterogens: L0B, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5afhA (A:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
    dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5afhB (B:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
    dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5afhC (C:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
    dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5afhC (C:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvdvvfwlqmswtd
    hylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsir
    qrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrs
    erfyecckepypdvtftvtfrkkg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5afhD (D:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
    dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5afhE (E:)
    gefqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswt
    dhylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsi
    rqrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkr
    serfyecckepypdvtftvtfrkkg