PDB entry 5af4

View 5af4 on RCSB PDB site
Description: Structure of Lys33-linked diUb
Class: signaling protein
Keywords: signaling protein
Deposited on 2015-01-19, released 2015-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96C32 (0-75)
      • engineered mutation (10)
    Domains in SCOPe 2.07: d5af4a_
  • Chain 'B':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96C32 (0-End)
      • engineered mutation (10)
    Domains in SCOPe 2.07: d5af4b_
  • Chain 'C':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96C32 (0-75)
      • engineered mutation (10)
    Domains in SCOPe 2.07: d5af4c_
  • Chain 'D':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96C32 (0-End)
      • engineered mutation (10)
    Domains in SCOPe 2.07: d5af4d_
  • Chain 'E':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96C32 (0-75)
      • engineered mutation (10)
    Domains in SCOPe 2.07: d5af4e_
  • Chain 'F':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96C32 (0-End)
      • engineered mutation (10)
    Domains in SCOPe 2.07: d5af4f_
  • Chain 'G':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96C32 (0-End)
      • engineered mutation (10)
    Domains in SCOPe 2.07: d5af4g_
  • Chain 'H':
    Compound: Ubiquitin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96C32 (0-End)
      • engineered mutation (10)
    Domains in SCOPe 2.07: d5af4h_
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5af4A (A:)
    mqifvktltgrtitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5af4B (B:)
    mqifvktltgrtitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5af4B (B:)
    mqifvktltgrtitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5af4C (C:)
    mqifvktltgrtitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5af4D (D:)
    mqifvktltgrtitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5af4D (D:)
    mqifvktltgrtitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5af4E (E:)
    mqifvktltgrtitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5af4F (F:)
    mqifvktltgrtitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5af4F (F:)
    mqifvktltgrtitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5af4G (G:)
    mqifvktltgrtitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5af4G (G:)
    mqifvktltgrtitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5af4H (H:)
    mqifvktltgrtitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlrgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5af4H (H:)
    mqifvktltgrtitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn
    iqkestlhlvlrlr