PDB entry 5aew

View 5aew on RCSB PDB site
Description: Crystal structure of II9 variant of Biphenyl dioxygenase from Burkholderia xenovorans LB400 in complex with biphenyl
Class: oxidoreductase
Keywords: oxidoreductase, biphenyl dioxygenase, bphae-ii9, biphenyl, polychlorinated biphenyls
Deposited on 2015-01-10, released 2016-04-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-11, with a file datestamp of 2016-05-06.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37333 (Start-458)
      • engineered mutation (334-335)
      • engineered mutation (337)
      • engineered mutation (340)
    Domains in SCOPe 2.07: d5aewa1, d5aewa2
  • Chain 'B':
    Compound: Biphenyl dioxygenase subunit beta
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aewb_
  • Chain 'C':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37333 (Start-458)
      • engineered mutation (334-335)
      • engineered mutation (337)
      • engineered mutation (340)
    Domains in SCOPe 2.07: d5aewc1, d5aewc2
  • Chain 'D':
    Compound: Biphenyl dioxygenase subunit beta
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aewd_
  • Chain 'E':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37333 (Start-458)
      • engineered mutation (334-335)
      • engineered mutation (337)
      • engineered mutation (340)
    Domains in SCOPe 2.07: d5aewe1, d5aewe2
  • Chain 'F':
    Compound: Biphenyl dioxygenase subunit beta
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aewf_
  • Chain 'G':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37333 (Start-458)
      • engineered mutation (334-335)
      • engineered mutation (337)
      • engineered mutation (340)
    Domains in SCOPe 2.07: d5aewg1, d5aewg2
  • Chain 'H':
    Compound: Biphenyl dioxygenase subunit beta
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aewh_
  • Chain 'I':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37333 (Start-458)
      • engineered mutation (334-335)
      • engineered mutation (337)
      • engineered mutation (340)
    Domains in SCOPe 2.07: d5aewi1, d5aewi2
  • Chain 'J':
    Compound: Biphenyl dioxygenase subunit beta
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aewj_
  • Chain 'K':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37333 (Start-458)
      • engineered mutation (334-335)
      • engineered mutation (337)
      • engineered mutation (340)
    Domains in SCOPe 2.07: d5aewk1, d5aewk2
  • Chain 'L':
    Compound: Biphenyl dioxygenase subunit beta
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aewl_
  • Chain 'M':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37333 (Start-458)
      • engineered mutation (334-335)
      • engineered mutation (337)
      • engineered mutation (340)
    Domains in SCOPe 2.07: d5aewm1, d5aewm2
  • Chain 'N':
    Compound: Biphenyl dioxygenase subunit beta
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aewn_
  • Chain 'O':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37333 (Start-458)
      • engineered mutation (334-335)
      • engineered mutation (337)
      • engineered mutation (340)
    Domains in SCOPe 2.07: d5aewo1, d5aewo2
  • Chain 'P':
    Compound: Biphenyl dioxygenase subunit beta
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aewp_
  • Chain 'Q':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37333 (Start-458)
      • engineered mutation (334-335)
      • engineered mutation (337)
      • engineered mutation (340)
    Domains in SCOPe 2.07: d5aewq1, d5aewq2
  • Chain 'R':
    Compound: Biphenyl dioxygenase subunit beta
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aewr_
  • Chain 'S':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37333 (Start-458)
      • engineered mutation (334-335)
      • engineered mutation (337)
      • engineered mutation (340)
    Domains in SCOPe 2.07: d5aews1, d5aews2
  • Chain 'T':
    Compound: Biphenyl dioxygenase subunit beta
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aewt_
  • Chain 'U':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37333
      • engineered mutation (334-335)
      • engineered mutation (337)
      • engineered mutation (340)
    Domains in SCOPe 2.07: d5aewu1, d5aewu2
  • Chain 'V':
    Compound: Biphenyl dioxygenase subunit beta
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aewv_
  • Chain 'W':
    Compound: Biphenyl dioxygenase subunit alpha
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37333 (Start-458)
      • engineered mutation (334-335)
      • engineered mutation (337)
      • engineered mutation (340)
    Domains in SCOPe 2.07: d5aeww1, d5aeww2
  • Chain 'X':
    Compound: Biphenyl dioxygenase subunit beta
    Species: Burkholderia xenovorans LB400 [TaxId:266265]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aewx_
  • Heterogens: FES, FE2, BNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5aewA (A:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflpgintirtwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewA (A:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflpgintirtwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5aewB (B:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewB (B:)
    phffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrm
    iregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatp
    dtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnls
    mff
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5aewC (C:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflpgintirtwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewC (C:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflpgintirtwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5aewD (D:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewD (D:)
    phffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrm
    iregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatp
    dtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnls
    mff
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5aewE (E:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflpgintirtwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewE (E:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflpgintirtwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5aewF (F:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewF (F:)
    sphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnr
    miregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketat
    pdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnl
    smff
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5aewG (G:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflpgintirtwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewG (G:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflpgintirtwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5aewH (H:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewH (H:)
    ffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmir
    egeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdt
    fevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmf
    f
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5aewI (I:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflpgintirtwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewI (I:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflpgintirtwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5aewJ (J:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewJ (J:)
    wpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmiregeley
    sgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtfevnsa
    filyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5aewK (K:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflpgintirtwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewK (K:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflpgintirtwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5aewL (L:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewL (L:)
    hffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmi
    regeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpd
    tfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsm
    ff
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5aewM (M:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflpgintirtwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewM (M:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflpgintirtwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5aewN (N:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewN (N:)
    phffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrm
    iregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatp
    dtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnls
    mff
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5aewO (O:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflpgintirtwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewO (O:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflpgintirtwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >5aewP (P:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewP (P:)
    ffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmir
    egeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdt
    fevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmf
    f
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >5aewQ (Q:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflpgintirtwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewQ (Q:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflpgintirtwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >5aewR (R:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewR (R:)
    ffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmir
    egeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdt
    fevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmf
    f
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >5aewS (S:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflpgintirtwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewS (S:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeaffdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtv
    aiggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfr
    aawgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmti
    fptcsflpgintirtwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeq
    ddgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwm
    rmmsepswatlkp
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >5aewT (T:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewT (T:)
    hffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmi
    regeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpd
    tfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsm
    ff
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >5aewU (U:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflpgintirtwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewU (U:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekefdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtvai
    ggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfraa
    wgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmtifp
    tcsflpgintirtwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeqdd
    genwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwmrm
    msepswatlk
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >5aewV (V:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewV (V:)
    ffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmir
    egeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdt
    fevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmf
    f
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >5aewW (W:)
    mssaikevqgapvkwvtnwtpeairglvdqekglldpriyadqslyelelervfgrswll
    lgheshvpetgdflatymgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftc
    syhgwaydiagklvnvpfekeafcdkkegdcgfdkaewgplqarvatykglvfanwdvqa
    pdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttthl
    sgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywtegp
    aaelaeqrlghtgmpvrrmvgqhmtifptcsflpgintirtwhprgpneievwaftlvda
    dapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsqt
    ghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewW (W:)
    nwtpeairglvdqekglldpriyadqslyelelervfgrswlllgheshvpetgdflaty
    mgedpvvmvrqkdksikvflnqcrhrgmricrsdagnakaftcsyhgwaydiagklvnvp
    fekeafdkaewgplqarvatykglvfanwdvqapdletylgdarpymdvmldrtpagtva
    iggmqkwvipcnwkfaaeqfcsdmyhagttthlsgilagippemdlsqaqiptkgnqfra
    awgghgsgwyvdepgsllavmgpkvtqywtegpaaelaeqrlghtgmpvrrmvgqhmtif
    ptcsflpgintirtwhprgpneievwaftlvdadapaeikeeyrrhnirnfsaggvfeqd
    dgenwveiqkglrgykaksqplnaqmglgrsqtghpdfpgnvgyvyaeeaargmyhhwmr
    mmsepswatlkp
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >5aewX (X:)
    mtnpsphffktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmpl
    rtnrmiregeleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivk
    etatpdtfevnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastll
    snnlsmff
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aewX (X:)
    fktfewpskaaglelqneieqfyyreaqlldhrayeawfalldkdihyfmplrtnrmire
    geleysgdqdlahfdethetmygrirkvtsdvgwaenppsrtrhlvsnvivketatpdtf
    evnsafilyrnrlerqvdifagerrdvlrradnnlgfsiakrtilldastllsnnlsmff