PDB entry 5aes

View 5aes on RCSB PDB site
Description: Crystal Structure of murine Chronophin (Pyridoxal Phosphate Phosphatase) in Complex with a PNP-derived Inhibitor
Class: hydrolase
Keywords: hydrolase, pdxp, plpp, haloacid dehalogenase, had phosphatase, had hydrolase
Deposited on 2015-01-09, released 2015-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyridoxal phosphate phosphatase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60487 (1-End)
      • expression tag (0)
      • conflict (101)
    Domains in SCOPe 2.07: d5aesa1, d5aesa2
  • Chain 'B':
    Compound: pyridoxal phosphate phosphatase
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60487 (1-End)
      • conflict (101)
    Domains in SCOPe 2.07: d5aesb_
  • Heterogens: MG, 5B0, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5aesA (A:)
    gmarcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsn
    nsrrarpelalrfarlgfaglraeqlfssalcaarllrqrlpgppdasgavfvlggeglr
    aelraaglrlagdpgedprvravlvgydeqfsfsrlteacahlrdpdcllvatdrdpwhp
    lsdgsrtpgtgslaaavetasgrqalvvgkpspymfqcitedfsvdpartlmvgdrletd
    ilfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadlmegled
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aesA (A:)
    gmarcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsn
    nsrrarpelalrfarlgfaglraeqlfssalcaarllrqrlpgppdasgavfvlggeglr
    aelraaglrlagdpgedprvravlvgydeqfsfsrlteacahlrdpdcllvatdrdpwhp
    lsdgsrtpgtgslaaavetasgrqalvvgkpspymfqcitedfsvdpartlmvgdrletd
    ilfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadlmegl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5aesB (B:)
    gmarcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsn
    nsrrarpelalrfarlgfaglraeqlfssalcaarllrqrlpgppdasgavfvlggeglr
    aelraaglrlagdpgedprvravlvgydeqfsfsrlteacahlrdpdcllvatdrdpwhp
    lsdgsrtpgtgslaaavetasgrqalvvgkpspymfqcitedfsvdpartlmvgdrletd
    ilfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadlmegled
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aesB (B:)
    marcerlrgaalrdvlgqaqgvlfdcdgvlwngerivpgapellqrlaragkntlfvsnn
    srrarpelalrfarlgfaglraeqlfssalcaarllrqrlpgppdasgavfvlggeglra
    elraaglrlagdpgedprvravlvgydeqfsfsrlteacahlrdpdcllvatdrdpwhpl
    sdgsrtpgtgslaaavetasgrqalvvgkpspymfqcitedfsvdpartlmvgdrletdi
    lfghrcgmttvltltgvssleeaqayltagqrdlvphyyvesiadlmegle