PDB entry 5aeb

View 5aeb on RCSB PDB site
Description: Crystal structure of the class B3 di-zinc metallo-beta-lactamase LRA- 12 from an Alaskan soil metagenome.
Class: hydrolase
Keywords: hydrolase, mbl, carbapenemase, metagenomics, carbapenem-resistance, environmental resistome
Deposited on 2015-08-27, released 2015-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lra-12
    Species: UNCULTURED BACTERIUM BLR12 [TaxId:506514]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aeba_
  • Chain 'B':
    Compound: lra-12
    Species: UNCULTURED BACTERIUM BLR12 [TaxId:506514]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5aebb_
  • Heterogens: ZN, SO4, CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5aebA (A:)
    hmasqkvkeptvsnadwskpyrpfriagnlyyigtydlacylittkqgniivntglaasa
    lqiknnikalgfkltdtkillttqahydhlgamaeikkitgaklmadegdatvmadggss
    dyafgghgsmfepiiadrllhdkdtiqlgdtklvmlhhpghtkgscsflfdtkdeqrsyr
    ilianmptiviekkfsevssypgiakdyaytlqamknlsfdiwvashasqfsmhskhkpg
    dgynpksfmdrkgydesldklqkeyekhlnen
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aebA (A:)
    vkeptvsnadwskpyrpfriagnlyyigtydlacylittkqgniivntglaasalqiknn
    ikalgfkltdtkillttqahydhlgamaeikkitgaklmadegdatvmadggssdyafgg
    hgsmfepiiadrllhdkdtiqlgdtklvmlhhpghtkgscsflfdtkdeqrsyrilianm
    ptiviekkfsevssypgiakdyaytlqamknlsfdiwvashasqfsmhskhkpgdgynpk
    sfmdrkgydesldklqkeyekhln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5aebB (B:)
    hmasqkvkeptvsnadwskpyrpfriagnlyyigtydlacylittkqgniivntglaasa
    lqiknnikalgfkltdtkillttqahydhlgamaeikkitgaklmadegdatvmadggss
    dyafgghgsmfepiiadrllhdkdtiqlgdtklvmlhhpghtkgscsflfdtkdeqrsyr
    ilianmptiviekkfsevssypgiakdyaytlqamknlsfdiwvashasqfsmhskhkpg
    dgynpksfmdrkgydesldklqkeyekhlnen
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aebB (B:)
    qkvkeptvsnadwskpyrpfriagnlyyigtydlacylittkqgniivntglaasalqik
    nnikalgfkltdtkillttqahydhlgamaeikkitgaklmadegdatvmadggssdyaf
    gghgsmfepiiadrllhdkdtiqlgdtklvmlhhpghtkgscsflfdtkdeqrsyrilia
    nmptiviekkfsevssypgiakdyaytlqamknlsfdiwvashasqfsmhskhkpgdgyn
    pksfmdrkgydesldklqkeyekhln