PDB entry 5aea

View 5aea on RCSB PDB site
Description: Crystal structure of human NCAM domain 1
Class: cell adhesion
Keywords: cell adhesion, ncam
Deposited on 2015-08-27, released 2016-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neural cell adhesion molecule 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13591 (0-96)
      • expression tag (97-99)
    Domains in SCOPe 2.06: d5aeaa1, d5aeaa2
  • Chain 'B':
    Compound: Neural cell adhesion molecule 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13591 (0-96)
      • expression tag (97-98)
    Domains in SCOPe 2.06: d5aeab1, d5aeab2
  • Heterogens: FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5aeaA (A:)
    lqvdivpsqgeisvgeskfflcqvagdakdkdiswfspngekltpnqqrisvvwnddsss
    tltiynaniddagiykcvvtgedgseseatvnvkifqaaadykddddkaadykddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aeaA (A:)
    lqvdivpsqgeisvgeskfflcqvagdakdkdiswfspngekltpnqqrisvvwnddsss
    tltiynaniddagiykcvvtgedgseseatvnvkifqaaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5aeaB (B:)
    lqvdivpsqgeisvgeskfflcqvagdakdkdiswfspngekltpnqqrisvvwnddsss
    tltiynaniddagiykcvvtgedgseseatvnvkifqaaadykddddkaadykddddk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5aeaB (B:)
    lqvdivpsqgeisvgeskfflcqvagdakdkdiswfspngekltpnqqrisvvwnddsss
    tltiynaniddagiykcvvtgedseseatvnvkifqaa